DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2875 and SPBC1604.06c

Sequence 1:NP_570069.1 Gene:CG2875 FlyBaseID:FBgn0029672 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_596634.1 Gene:SPBC1604.06c PomBaseID:SPBC1604.06c Length:485 Species:Schizosaccharomyces pombe

Alignment Length:492 Identity:142/493 (29%)
Similarity:239/493 (48%) Gaps:44/493 (9%)


  Fly    14 KSLAKKKLQSKANSLLNAEQVDIKTLKGFVQLLKNTPD--NMPAGEVMNTLEVIFKN-LLKRKAI 75
            |.|..:..:|:.|  ||    :|..|..::.|..::.|  |..|..:......:.:| ||||...
pombe     3 KDLENEIYKSRKN--LN----NILVLFDYIDLSNHSIDEVNDAAAALCRVYCYLSRNGLLKRPKE 61

  Fly    76 DGTEKQGLKIKKLYEETWLLLIENLL-VDSQCSV-AVKV-----CMQLIKVEA---KHPIAPNKG 130
            |.:.... ::|....:.::...|.|. :.|..:| |::|     .|:|.|.|:   ::....|: 
pombe    62 DDSSANA-QVKNWVCDNYINYTEKLTEIFSMANVEALQVSFLTMTMRLCKAESQMDENGTFRNQ- 124

  Fly   131 WPTYWIRGMLETLINSDTTP-------TTALANYGK----YCKNLDVLEITLTQLKSLVPDEDFK 184
               ::||..||.|.:|..:.       |:.|..|..    :.||..  ::..:.::|...|:...
pombe   125 ---FYIRFCLELLSSSQLSDICIKDFVTSYLVPYDDVRFFFYKNSK--KVISSLIESSKTDDPMA 184

  Fly   185 DSPIKAMNFLSIVNLLDMGKSVLSTADYHVESAKKQTFNYELNRKRLNNLWATIMAKGNEVDEKL 249
            :..|.|.|.:.|::.:.......||:.:..|.:...|....:.| .....|.:.::....|:  |
pombe   185 NLDIVAFNTIRILSAIPSPLPSSSTSSWADEPSPSSTETSSIKR-AFQESWLSALSLPLSVN--L 246

  Fly   250 HRQILVVLLERVINHLNDPIQLTDFLMDSLHQFDGPIALLALQGIFTLMQKQNITYPDVYEKLYN 314
            ::|:|.|:.:|||..|..|..|.|||.|:.:.... ::||||.|:||||...|:.||..|.|||.
pombe   247 YKQVLNVIHKRVIPFLQKPNLLMDFLTDAYNSHHA-VSLLALNGLFTLMISHNLDYPLFYPKLYA 310

  Fly   315 MFYPRMFHNKYKARLFYLADIFLTSTHLPENLVAAFVKRLARLALQSPTEDAVIMIRFVCNLLLR 379
            :....:.:.|.::|.|.|.|:||:|||||..|:|:|:||||||||.:|.....|:|.|:.|.|.|
pombe   311 LLDRNLLYLKTRSRFFRLLDLFLSSTHLPATLIASFIKRLARLALTAPPGAIAIVIPFIYNCLQR 375

  Fly   380 HTGLQKLIRASHAVDEVSDPYNQTETDPVKSEAINSSLWEITLLQKHVVPEVANAARFINSSLPV 444
            |....:::..|.|  |..|.::..:.||:.:.||.|||||::.||.|....:|:.|..::.....
pombe   376 HPTCMQMLHRSSA--ESGDSFDFDQPDPLLTGAIESSLWELSTLQNHYYSNIASLASIMSQKFTK 438

  Fly   445 MEFDLAPLLDRKECNIFDDELQSKAK-QFALNYERPT 480
            ..::|...||.....:.|.||:...| :..:.:|:.|
pombe   439 PRYELEDFLDHGYATMCDAELRRPLKNEPPIEFEKRT 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2875NP_570069.1 CBF 287..435 CDD:281851 64/148 (43%)
SPBC1604.06cNP_596634.1 CBF 283..429 CDD:281851 64/148 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H40545
Inparanoid 1 1.050 157 1.000 Inparanoid score I1249
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004223
OrthoInspector 1 1.000 T1125970
orthoMCL 1 0.900 OOG5_128560
Panther 1 1.100 LDO PTHR12455
Phylome 1 0.910 0.938 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1838
TreeFam 1 0.960
109.950

Return to query results.
Submit another query.