DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2875 and Noc4l

Sequence 1:NP_570069.1 Gene:CG2875 FlyBaseID:FBgn0029672 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_705798.2 Gene:Noc4l MGIID:2140843 Length:516 Species:Mus musculus

Alignment Length:503 Identity:143/504 (28%)
Similarity:252/504 (50%) Gaps:58/504 (12%)


  Fly     3 PLTVKVNDDTGKSL-AKKKLQSKANSLLNAEQVDIKTLKGFVQLLKNTPDNMPAGEVMNTLEVIF 66
            |.:.....:.|:.| |....:.:||::.:...|          |....|:.:..|  :.|...:|
Mouse     5 PASASSRQELGRLLEAVLTSRGQANAVFDILAV----------LQSEEPEEIEEG--VRTCSRLF 57

  Fly    67 KNLLKRK------------AIDGTEKQGLKIKKLYEETWLL--------LIENLLVDSQCSV--- 108
            ..||:|:            |:.|::....|.|     .|:.        .:|.||......|   
Mouse    58 GTLLEREELFVGSLPSEDTALAGSQGATYKYK-----VWIRHRYHSCCNRLEELLAHPTFQVKEL 117

  Fly   109 AVKVCMQLIKVEAKHPIAPNKGWPTYWI--RGMLETLINSDTTP----TTALANYGKYCKNLDVL 167
            |:|..|:.:::|...|:...: |.::::  |.:...::....||    :..::::.:|.:..|:.
Mouse   118 ALKTLMKFVQLEGAKPLEKPQ-WESHYLFPRTLFRAVVGGLLTPEDDHSLLISHFCEYLEYDDIR 181

  Fly   168 EITLTQLKSLVPDEDFKDSPIKAM---NFLSIVNLLDMGKSVLSTADYHVESA----KKQTFNYE 225
            ..|:....|::.....:...:...   |..::::.:.:........:::|:.|    |.:..:.:
Mouse   182 YHTMQVATSIMARATSQQPEVSLTLWNNAFTLLSAVSLPLQECELTNFYVKHAQTSDKWKVVHLK 246

  Fly   226 LNRKRLNNLWATIMAKGNEVDEKLHRQILVVLLERVINHLNDPIQLTDFLMDSLHQFDGPIALLA 290
            .::|....:|...:.  :::...|::::||.:.:.::.||..|..:.||| .|.....|.|:|||
Mouse   247 EHKKAFQEMWLGFLK--HKLPLSLYKKVLVAMHDSILPHLAQPTLMIDFL-TSACDVGGAISLLA 308

  Fly   291 LQGIFTLMQKQNITYPDVYEKLYNMFYPRMFHNKYKARLFYLADIFLTSTHLPENLVAAFVKRLA 355
            |.|:|.|:.|.|:.|||.|:|||.:..|.:||.||:||.|:|||:||:|:|||..|||||.||||
Mouse   309 LNGLFILIHKHNLEYPDFYQKLYGLLDPSIFHVKYRARFFHLADLFLSSSHLPAYLVAAFAKRLA 373

  Fly   356 RLALQSPTEDAVIMIRFVCNLLLRHTGLQKLIRASHAVDEVSDPYNQTETDPVKSEAINSSLWEI 420
            ||||.:|.|..::::..:||||.||...:.::......:..:|||:.||.||.:|.|:.|.|||:
Mouse   374 RLALTAPPEALLMVLPLICNLLRRHPACRVMVHRPQGPELDADPYDPTEKDPARSRALESCLWEL 438

  Fly   421 TLLQKHVVPEVANAARFINSSLPVMEFDLAPLLDRKECNIFDDELQSK 468
            ..||:|..|||:.||..||..|.|.|..:||||:.....||:.:|:.|
Mouse   439 QTLQQHYHPEVSKAASVINQVLSVPEVSIAPLLELTAYEIFEQDLKKK 486

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2875NP_570069.1 CBF 287..435 CDD:281851 74/148 (50%)
Noc4lNP_705798.2 CBF 305..453 CDD:281851 74/148 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C214358672
eggNOG 1 0.900 E1_KOG2154
Hieranoid 1 1.000
Homologene 1 1.000 H40545
Inparanoid 1 1.050 210 1.000 Inparanoid score I3641
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004223
OrthoInspector 1 1.000 T1085634
orthoMCL 1 0.900 OOG5_128560
Panther 1 1.100 LDO PTHR12455
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1838
TreeFam 1 0.960
1211.780

Return to query results.
Submit another query.