DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10803 and RO60

Sequence 1:NP_570064.1 Gene:CG10803 FlyBaseID:FBgn0029666 Length:637 Species:Drosophila melanogaster
Sequence 2:XP_006711558.1 Gene:RO60 HGNCID:11313 Length:560 Species:Homo sapiens

Alignment Length:634 Identity:125/635 (20%)
Similarity:231/635 (36%) Gaps:145/635 (23%)


  Fly    64 MEKEAISNQPLKDEPSKDEPNQSEGTAISTIPAIDKLRRFCFIGSTDEPVYTTPALDLVVENNFA 128
            ||:.....|||.:   |...|..:| .:..:..:::|.||...|| :...|......|.:||   
Human     1 MEESVNQMQPLNE---KQIANSQDG-YVWQVTDMNRLHRFLCFGS-EGGTYYIKEQKLGLEN--- 57

  Fly   129 SLKELCSQVSED----ELVECLLSVLGSEPNEEQPPRPDEPLLILAVFFTTCEDEKKRNAVRNRF 189
              .|...::.||    |:::.:.|.     ::|......||:|......:.|.|...:.|.....
Human    58 --AEALIRLIEDGRGCEVIQEIKSF-----SQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAV 115

  Fly   190 TDLITSESDLLLFVQLVKRVQKLLERKTPFNRTVRKAVLNWYGTK-SLDRLLHFWSIGDGNRWPA 253
            :::....:.|..|:|..|.:::.: :...:.|.:|||:.:||..| .:...|........|.| :
Human   116 SEVCRIPTHLFTFIQFKKDLKESM-KCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGW-S 178

  Fly   254 HRDLLYRLH--------------------FRHANFLPEIIAALRLLSSSPKELSQWPDFLTPLTS 298
            |:|||...|                    |:.....|.:....:.::...||:.:         .
Human   179 HKDLLRLSHLKPSSEVKLEKTATQKGGFTFQFCGLKPRLAIVTKYITKGWKEVHE---------L 234

  Fly   299 FRETIEGVVKLRLLTDPEQAISIVKKLSLSWEHVPFHLLHDPRLA--HFLIPHMS----YEQLLQ 357
            ::|....|...:||...| |:..||:.....|.:  ||:.:.||.  |.|..|:.    ::.|||
Human   235 YKEKALSVETEKLLKYLE-AVEKVKRTRDELEVI--HLIEEHRLVREHLLTNHLKSKEVWKALLQ 296

  Fly   358 KWPRLSRL---------------NSRVRPFAEQLLDKKKLKASNVPPVRLLLE------------ 395
            :.|..:.|               ||.|....|:|.::|.||.:.:.|..:|:.            
Human   297 EMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRG 361

  Fly   396 DMRLRKPKKVVNQLVLPSSLKNKNTFKFQCATTSFQKASFLHSVYEISFGLNKALGRR----LHI 456
            .::.|..::::..|                 ..:|.|          :|...:..|:|    :.:
Human   362 KLKWRPDEEILKAL-----------------DAAFYK----------TFKTVEPTGKRFLLAVDV 399

  Fly   457 TLNLEQAYLGKYLSGPCRSLKYLDALVALGFGYFRSDRKVTVEFWHDRSGKLKALPWTNEMSVSE 521
            :.::.|..||..|:..       ....|:.....|:::...|..:.|   ::...|.|.:|::.:
Human   400 SASMNQRVLGSILNAS-------TVAAAMCMVVTRTEKDSYVVAFSD---EMVPCPVTTDMTLQQ 454

  Fly   522 AKTCCENQKVGKVRQSLNEILFRALLDMQNT-FDVFLVLVPG---AARGNPENNSKCLAALMDKY 582
            ..........|....||..|    .....|| .|||:|....   |...:|       |..:.:|
Human   455 VLMAMSQIPAGGTDCSLPMI----WAQKTNTPADVFIVFTDNETFAGGVHP-------AIALREY 508

  Fly   583 REKRNSNAKFIMVSLRQRQRSMIYSSGRNENLLELCSLDKHTPRLINAF 631
            |:|.:..||.|:..:  .......:...:..:|::|..|.....:|..|
Human   509 RKKMDIPAKLIVCGM--TSNGFTIADPDDRGMLDMCGFDTGALDVIRNF 555

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10803NP_570064.1 TROVE <197..394 CDD:283406 54/239 (23%)
RO60XP_006711558.1 TROVE 17..391 CDD:283406 83/427 (19%)
vWFA 392..527 CDD:294047 31/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191427349
eggNOG 1 0.900 E1_KOG4465
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I5341
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D223041at33208
OrthoFinder 1 1.000 FOG0006534
OrthoInspector 1 1.000 T1075530
orthoMCL 1 0.900 OOG5_132823
Panther 1 1.100 LDO PTHR14202
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2766
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.