DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10803 and ro60

Sequence 1:NP_570064.1 Gene:CG10803 FlyBaseID:FBgn0029666 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001032474.1 Gene:ro60 ZFINID:ZDB-GENE-051113-300 Length:534 Species:Danio rerio

Alignment Length:630 Identity:130/631 (21%)
Similarity:213/631 (34%) Gaps:197/631 (31%)


  Fly    89 TAISTIPAIDKLRRFCFIGSTDEPVYTTPALDLVVENNFASLKELCSQVSEDELVECLLSVLGSE 153
            :|..::.|...||||...|| :...|:|....|.:||..:             |::.:....|||
Zfish    20 SADRSVTAAVCLRRFLCYGS-ESSTYSTKECPLGIENALS-------------LMQLIEGGRGSE 70

  Fly   154 PNEE--------QPPRPDEPLLILAVFFTTCE---DEKKRNAVRNRFTDLITSESDLLLFVQLVK 207
            ..:|        :..||:..|..|||    |.   |.|.|.|......:|..|...|..|||..|
Zfish    71 VVDEVRRFNLEGRAVRPNPGLFTLAV----CSQHADCKTRQAALRALKELCRSPVQLFTFVQYKK 131

  Fly   208 RVQKLLERKTPFNRTVRKAVLNWYG-------TKSLDRLLH--FWSIGDGNRWPAHRDLLYRLHF 263
               :|.|....:.|.:|:.|.:||.       .:::.:..|  .||         |:|||...|.
Zfish   132 ---ELKEGSGMWGRALRRVVTDWYNGQDGISLAQAVTKCKHRAGWS---------HQDLLRLSHM 184

  Fly   264 RHANFLPEIIAALRLLSSSPK---ELSQWPDFLTPLTSFRETIEGVVKLRLLTDPEQAISIVKKL 325
            :.||  ..|....:.::...|   |.....|....|......:|.|.|.:..||.::.|      
Zfish   185 KPAN--DNIALVCKYITKGWKGVEEAYAEKDKSEDLQKVFAYLEAVEKAKHSTDEQELI------ 241

  Fly   326 SLSWEHVPFHLLHDPRLAHFLIPHMSYEQLLQKWPRLSRLNSRVRPFAEQLLDKKKLKA-SNVPP 389
                     ||:.:.||..        ||||                ...|..|:..|| ....|
Zfish   242 ---------HLIEEQRLGK--------EQLL----------------TNHLKSKEVWKALLKEMP 273

  Fly   390 VRLLLEDMRLRKPKKVVNQLVLPSS---------------LKNKNT--FKFQCATTSFQK----- 432
            |.:||:.:    .|...|::::|.|               ||...|  |....|:.::::     
Zfish   274 VAVLLKHL----GKLTANKVLIPGSPDIAAVCGRIQDETVLKKAKTQPFNILAASENYKRGHGKR 334

  Fly   433 ----------------ASFLHSVYEISFGLNKALGRRLHITLNLEQAYLGKYLSGPCRSLKYLDA 481
                            .:|..|:..:     :|.|:|..:.:::..:     ||..||.......
Zfish   335 SKLKWEPDRDLVQALDCAFCKSISTV-----EATGKRFLVAVDISSS-----LSSLCRGSSISTV 389

  Fly   482 LVALGFGYFRSDRKVTVEFWHDRSGKLKALPWTNEMSVSE----------AKTCC--------EN 528
            .||.......:..:...:......|.|.....:::|::.:          ..|.|        ||
Zfish   390 AVAAAVCMIIAQTEPNAQIVVFSEGNLLPCTVSSDMTLMQVAGLLIQTPGGSTDCSLPITWASEN 454

  Fly   529 QKVGKVRQSLNEILFRALLDMQNTFDVFLVLVPGAARG--NPENNSKCLAALMDKYREKRNSNAK 591
            :|                     |.|||::|......|  ||.:..|       .||:|.:..:|
Zfish   455 EK---------------------TVDVFIILTNNQTNGRENPADTLK-------MYRQKSSVFSK 491

  Fly   592 FIMVSLRQRQRSMIYSSGRNENLLELCSLDKHTPRLINAFVRNKF 636
            .|:..|.....|:  :...:..:|::|..|.....:|:.|..:.|
Zfish   492 LIVCGLIANNLSI--ADPEDCGMLDICGFDSQAVDVIHNFALDIF 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10803NP_570064.1 TROVE <197..394 CDD:283406 48/210 (23%)
ro60NP_001032474.1 TROVE 17..365 CDD:283406 93/425 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191425861
eggNOG 1 0.900 E1_KOG4465
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D223041at33208
OrthoFinder 1 1.000 FOG0006534
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14202
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.