DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10803 and Ro60

Sequence 1:NP_570064.1 Gene:CG10803 FlyBaseID:FBgn0029666 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_001100653.1 Gene:Ro60 RGDID:1305083 Length:538 Species:Rattus norvegicus

Alignment Length:610 Identity:130/611 (21%)
Similarity:237/611 (39%) Gaps:119/611 (19%)


  Fly    64 MEKEAISNQPLKDEPSKDEPNQSEGTAISTIPAIDKLRRFCFIGSTDEPVYTTPALDLVVENNFA 128
            ||:.|...|||.|    ::...|||..:..:..:::|.||...||.....|.... .|.:||..|
  Rat     1 MEESANQLQPLSD----NQVANSEGGYVWQVTDMNRLHRFLCFGSEGGTCYIKEQ-KLGLENAEA 60

  Fly   129 SLKELCSQVSEDELVECLLSVLGSEPNEEQPPRPDEPLLILAVFFTTCEDEKKRNAVRNRFTDLI 193
            .:: |.......|:::.:.|.     ::|......||||......:.|.|...:.|......::.
  Rat    61 LIR-LIEDGRGSEVIQEIKSF-----SQEGRTAKQEPLLFALAICSQCADVSTKQAAFKAVPEVC 119

  Fly   194 TSESDLLLFVQLVKRVQKLLERKTPFNRTVRKAVLNWYGTK-SLDRLLHFWSIGDGNRWPAHRDL 257
            ...:.|..|:|..|.:::.: :...:.|.:||||.:||..| .:...|........|.| :|:||
  Rat   120 RIPTHLFTFIQFKKDLKESM-KCGMWGRALRKAVADWYNEKGGMAVALAVTKYKQRNGW-SHKDL 182

  Fly   258 LYRLHFRHANFLPE---IIAALRLLSSSPKEL-SQWPDFLTPLT----SFRETIEGVVKLRLLTD 314
            |...|.:     |.   :....:.::...||: .|:.:  .||:    ...:.:|.|.|::...|
  Rat   183 LRLSHLK-----PNSEGLAIVTKYITKGWKEVHEQYKE--KPLSVETDKLLKYLEAVEKVKRTKD 240

  Fly   315 PEQAISIVKKLSLSWEHVPFHLLHDPRLAHFLIPHMSYEQLLQKWPRLSRL--------NSRVRP 371
            ..:...:::      ||   .|:.:..|...|.....::.|||:.|..:.|        ||.:.|
  Rat   241 DLEVTHLIE------EH---QLVREQLLTSHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEP 296

  Fly   372 -------FAEQLLDKKKLKASNVPPVRLL--LEDMR----LR-KPKKVVNQLVLPSSLKNKNTFK 422
                   ..|:|.::|.||.:.:.|..:|  ||..|    || |.|.:.::.:|           
  Rat   297 GSSEVSLVCEKLSNEKLLKKARIHPFHVLTALETYRTGHGLRGKLKWIPDKEIL----------- 350

  Fly   423 FQCATTSFQKASFLHSVYEISFGLNKALGRR----LHITLNLEQAYLGKYLSGPCRSLKYLDALV 483
             |....:|.|          :|...:..|:|    :.::.:::|..||..|:..       ....
  Rat   351 -QALDAAFYK----------TFKTVEPTGKRFLLAVDVSGSMDQRVLGSVLNAS-------TVAA 397

  Fly   484 ALGFGYFRSDRKVT-VEFWHDRSGKLKALPWTNEMSVSEAKTCCENQKVGKVRQSLNEILFRALL 547
            |:.....|::::.: |.|..|    :...|.|.:|::.:..|.......|....||      .::
  Rat   398 AMCMVVTRTEKESSVVAFACD----MVPFPVTTDMTLQQVLTAMNKVPAGTTDCSL------PMI 452

  Fly   548 DMQNT---FDVFLVLVPG---AARGNPENNSKCLAALMDKYREKRNSNAKFIMVSLRQRQRSMIY 606
            ..|.|   .|||:|....   |.:.:|       |..:.:||:|....||.::..:  .......
  Rat   453 WAQKTGTAADVFIVFTDNETFAGQVHP-------AIALREYRKKMAIPAKLLVCGM--TSNGFTI 508

  Fly   607 SSGRNENLLELCSLDKHTPRLINAF 631
            :...:..:|::|..|.....:|..|
  Rat   509 ADPDDRGMLDMCGFDTAALDVIRNF 533

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10803NP_570064.1 TROVE <197..394 CDD:283406 50/223 (22%)
Ro60NP_001100653.1 TROVE 16..369 CDD:283406 87/400 (22%)
vWFA 372..489 CDD:238119 27/141 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191426364
eggNOG 1 0.900 E1_KOG4465
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5279
OMA 1 1.010
OrthoDB 1 1.010 D223041at33208
OrthoFinder 1 1.000 FOG0006534
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132823
Panther 1 1.100 LDO PTHR14202
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1110.770

Return to query results.
Submit another query.