DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10803 and Ro60

Sequence 1:NP_570064.1 Gene:CG10803 FlyBaseID:FBgn0029666 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_038863.1 Gene:Ro60 MGIID:106652 Length:538 Species:Mus musculus

Alignment Length:616 Identity:134/617 (22%)
Similarity:245/617 (40%) Gaps:131/617 (21%)


  Fly    64 MEKEAISNQPLKDEPSKDEPNQSEGTAISTIPAIDKLRRFCFIGSTDEPVYTTPALDLVVENNFA 128
            ||..|...|||    |:.:...|||..:..:..:::||||...|| :...|......|.:||   
Mouse     1 MEGSANQLQPL----SETQVVNSEGGCVWQVTDMNRLRRFLCFGS-EGGTYYIKEQKLGLEN--- 57

  Fly   129 SLKELCSQVSED----ELVECLLSVLGSEPNEEQPPRPDEPLLILAVFFTTCEDEKKRNAVRNRF 189
              .|...::.||    |:::.:.|.     ::|......||||......:.|.|...:.|.....
Mouse    58 --AEALIRLIEDGRGCEVIQEIKSF-----SQEGRTAKQEPLLFALAVCSQCADINTKQAAFKAV 115

  Fly   190 TDLITSESDLLLFVQLVKRVQKLLERKTPFNRTVRKAVLNWYGTK-SLDRLLHFWSIGDGNRWPA 253
            .::....:.|..|:|..|.:::.: :...:.|.:||||.:||..| .:...|........|.| :
Mouse   116 PEVCRIPTHLFTFIQFKKDLKESM-KCGMWGRALRKAVADWYNEKGGMAVALVVTKYKQRNGW-S 178

  Fly   254 HRDLLYRLHFRHANFLPEIIAAL-RLLSSSPKELSQWPDFLTPLTSFRE---TIEGVVKLRLLTD 314
            |:|||...|.:.::   |.:|.: :.::...||:.:         .::|   ::|....|:.|  
Mouse   179 HKDLLRLSHLKPSS---EGLAIVTKYITKGWKEVHE---------EYKEKALSVEAEKLLKYL-- 229

  Fly   315 PEQAISIVKKLSLSWEHVPFHLLHDPRLA--HFLIPHMS----YEQLLQKWPRLSRL-------- 365
              :|:..||:.....|.:  ||:.:.:|.  |.|..|:.    ::.|||:.|..:.|        
Mouse   230 --EAVEKVKRTKDDLEVI--HLIEEHQLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTA 290

  Fly   366 -------NSRVRPFAEQLLDKKKLKASNVPPVRLL--LEDMR----LR-KPKKVVNQLVLPSSLK 416
                   ||.|....|:|.::|.||.:.:.|..:|  ||..|    || |.|.:.::.:|.:   
Mouse   291 NSVLEPGNSEVSLICEKLSNEKLLKKARIHPFHVLIALETYRAGHGLRGKLKWIPDKDILQA--- 352

  Fly   417 NKNTFKFQCATTSFQKASFLHSVYEISFGLNKALGRR----LHITLNLEQAYLGKYLSGPCRSLK 477
                               |.:.:..:|...:..|:|    :.::.::.|..||..|:..     
Mouse   353 -------------------LDAAFYTTFKTVEPTGKRFLLAVDVSASMNQRALGSVLNAS----- 393

  Fly   478 YLDALVALGFGYFRSDRKVT-VEFWHDRSGKLKALPWTNEMSVSEAKTCCENQKVGKVRQSLNEI 541
              ....|:.....|::::.: |.|..|    :...|.|.:|::.:..|.......|....||   
Mouse   394 --TVAAAMCMVVTRTEKESSVVAFACD----MVPFPVTTDMTLQQVLTAMNKVPAGNTDCSL--- 449

  Fly   542 LFRALLDMQNT---FDVFLVLVPG---AARGNPENNSKCLAALMDKYREKRNSNAKFIMVSLRQR 600
               .::..|.|   .|||:|....   |.:.:|       |..:.:||:|.:..||.|:..:  .
Mouse   450 ---PMIWAQKTDTAADVFVVFTDNETFAGQVHP-------AVALREYRKKMDIPAKLIVCGM--T 502

  Fly   601 QRSMIYSSGRNENLLELCSLDKHTPRLINAF 631
            ......:...:..:|::|..|.....:|..|
Mouse   503 SNGFTIADPDDRGMLDMCGFDTAALDVIRNF 533

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10803NP_570064.1 TROVE <197..394 CDD:283406 53/225 (24%)
Ro60NP_038863.1 TROVE 16..369 CDD:283406 90/406 (22%)
RNA-binding. {ECO:0000250|UniProtKB:P42700} 120..284 43/184 (23%)
VWFA-like domain. {ECO:0000250|UniProtKB:P42700} 361..538 39/200 (20%)
vWFA 372..489 CDD:238119 27/141 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191428688
eggNOG 1 0.900 E1_KOG4465
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5354
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006534
OrthoInspector 1 1.000 T1085637
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14202
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2766
TreeFam 1 0.960
1110.890

Return to query results.
Submit another query.