DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10803 and rop-1

Sequence 1:NP_570064.1 Gene:CG10803 FlyBaseID:FBgn0029666 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_505638.1 Gene:rop-1 WormBaseID:WBGene00004405 Length:643 Species:Caenorhabditis elegans

Alignment Length:660 Identity:135/661 (20%)
Similarity:251/661 (38%) Gaps:166/661 (25%)


  Fly    73 PLKDEPSKDEPNQSEGTAISTI-PAID--KLRRFCFIGSTDEPVYTTPALDLVVENNFASLKELC 134
            |.:.|..||  .|.|..|...: |..|  ::|||..:|| |:..|...:..:.::|....:|   
 Worm    52 PRQMEKVKD--GQVENNAGGFVFPVSDETQVRRFLILGS-DKGSYHQSSEKITIDNAQRIIK--- 110

  Fly   135 SQVSEDELVECLLSVLGSEPNEEQPPRPDEPLLILAVF--FTTCEDEKKRNA-VRNRFTDLITS- 195
              :.|......:|..|.....|.:.|:.:..:..||:.  .:|.:..||... :.|.::|.|.: 
 Worm   111 --IIEQGNGHMVLKELALINAENRNPKMNAMIFTLAICARISTHDTTKKTECPMLNAYSDYIRAL 173

  Fly   196 -ESDLLLFVQLVKRVQKLLE------------------RKTPFNRTVRKAVLNWYGTKSLDRLLH 241
             :|.|.|..::.:....|.|                  ..|.:.|::|.|:..||.||:.::|..
 Worm   174 HDSALDLIPEVCRTPTHLFEFVDYCQTISESTKAGGAKSSTGWGRSMRNAISKWYTTKTTEKLAM 238

  Fly   242 FWSIGDGNRWP-----AHRDLLYRLHFRHANFLP-----------------------EIIAALRL 278
            ..:     ::|     :||| |:||  .|.|.:.                       :::...|.
 Worm   239 LLT-----KYPQREGWSHRD-LFRL--AHPNLMDSRSHGQSEDRLEREQLFRFAVKGDLVKRKRK 295

  Fly   279 LSSSPKELSQ----WPDFLTPLTSFRE------------TIEGVVKLRLLTDPEQAISIVKKLSL 327
            :  |.:|:::    |......|....|            .:|..:||:.....|..::.:||..|
 Worm   296 M--SVEEVAEVEKVWDKKALKLPYTEEQLIKEEQSRALNLVEAYLKLKNEQSEEVIVAAIKKHGL 358

  Fly   328 SWEHVPFHLLHDPRLAHFL----IPHMSYEQLLQKWPRLSRLN-SRVRPFAEQLLDKKKLKASNV 387
            ..||:|...|:...:...|    :|..:..:.|.|...:..|: .||....::|.|:::|:.|.:
 Worm   359 VREHLPTTSLNSKLVWETLFDVSMPMTAMIRNLAKMTVVGALDEKRVDNIVKRLTDQEELRRSRI 423

  Fly   388 PPVRLLLEDMRLRKPKKVVNQLVLPSSLKNKNTFKFQ-------CATTSFQKASFLHSVYEISFG 445
            .|:.||            ..:.|......:|.:..::       .....|.|| |:::       
 Worm   424 HPINLL------------TARAVYAQGRGDKGSLTWEPNQKICDALEAGFYKA-FVNA------- 468

  Fly   446 LNKALGRRLHITLNLEQAYLGKYLSGP--CRSLKYLDALVALGFGYFRSDRKVTVEFWHDRSGKL 508
              ...|:|..:.|::..:...:..|.|  ||     :|...:......::.:|....:.|   ||
 Worm   469 --PPTGKRYCLALDVSGSMTSRVSSSPLSCR-----EAATGMSLINLHNEAEVRCVAFCD---KL 523

  Fly   509 KALPWTNEMSVSEAKTCCENQKVGKVRQSLNEILF-RALLDMQNT--------FDVFLVLVPG-- 562
            ..||:|.:.            |:|:|...:|.:.| |....:..|        ||||::....  
 Worm   524 TELPFTKDW------------KIGQVNDYVNNLDFGRTDCGLPMTWATENNLKFDVFIIYTDNDT 576

  Fly   563 -AARGNPENNSKCLAALMDKYREKRN-SNAKFIMVSLRQRQRSMIYSSGRNENLLELCSLDKHTP 625
             |...:|....|       ||||... .:||.|:::::....|:...|  :..:|::...|...|
 Worm   577 WAGEIHPFEAIK-------KYREASGIHDAKVIVMAMQAYDYSIADPS--DAGMLDITGFDSAVP 632

  Fly   626 RLINAFVRNK 635
            ::::.||..|
 Worm   633 QIVHEFVTGK 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10803NP_570064.1 TROVE <197..394 CDD:283406 54/264 (20%)
rop-1NP_505638.1 TROVE 63..473 CDD:283406 87/448 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191422427
eggNOG 1 0.900 E1_KOG4465
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D223041at33208
OrthoFinder 1 1.000 FOG0006534
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132823
Panther 1 1.100 LDO PTHR14202
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2766
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.