DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10803 and trove2

Sequence 1:NP_570064.1 Gene:CG10803 FlyBaseID:FBgn0029666 Length:637 Species:Drosophila melanogaster
Sequence 2:XP_002939107.1 Gene:trove2 XenbaseID:XB-GENE-968758 Length:538 Species:Xenopus tropicalis

Alignment Length:626 Identity:135/627 (22%)
Similarity:235/627 (37%) Gaps:151/627 (24%)


  Fly    64 MEKEAISNQPLKDEPSKDEPNQSEGTAISTIPAIDKLRRFCFIGSTDEPVYTTPALDLVVENNFA 128
            |:......|||.:   :..|| |||..:..:..:::||||...|| :...|......|..||..|
 Frog     1 MDDTVDQTQPLSE---RQVPN-SEGCYVWQVSDMNRLRRFLCFGS-EGGTYYIEEKKLGQENAEA 60

  Fly   129 SLKEL-----CSQVSEDELVECLLSVLGSEPNEEQPPRPDEPLLILAVFFTTCEDEKKRNAVRNR 188
            .|:.:     |..|.|.:..           ::|......||.|......:.|.|.|.:.|....
 Frog    61 LLRLIEDGKGCEVVQEIKTF-----------SQEGRAAKQEPTLFALAVCSQCSDIKTKQAAFRA 114

  Fly   189 FTDLITSESDLLLFVQLVKRVQKLLERKTPFNRTVRKAVLNWYGTK-SLDRLLHFWSIGDGNRWP 252
            ..::....:.|..|:|..|.:::.: :...:.|.:||||.:||.|| :|:..:........|.| 
 Frog   115 VPEVCRIPTHLFTFIQFKKDLKEGM-KCGMWGRALRKAVSDWYTTKDALNLAMAVTKYKQRNGW- 177

  Fly   253 AHRDLLYRLHFRHANFLPEIIAALRLLSSSPKELSQWPDFLTPLTSFRE-----TIEGVVKLRLL 312
            :|:|||...|.:.|:....::|  :.:|...||:.:         :::|     ..|.|:|..  
 Frog   178 SHKDLLRLSHIKPASEGLTMVA--KYVSKGWKEVQE---------AYKEKELSPETEKVLKYL-- 229

  Fly   313 TDPEQAISIVKKLSLSWEHVPFHLLHDPRLA--HFLIPHMS----YEQLLQKWPR---------- 361
                :|...||:.....|.:  ||:.:.||.  |.|..|:.    ::.|||:.|.          
 Frog   230 ----EATERVKRTKDELEVI--HLIEEYRLVREHLLTIHLKSKEIWKALLQEMPLTALLRNLGKM 288

  Fly   362 -----LSRLNSRVRPFAEQLLDKKKLKASNVPPVRLLLEDMRLRKPKKVVNQLVLPSSLKNKNTF 421
                 ||..:..|....|:|.::|.||.:.:.|..:|   :.|...||         ...|:...
 Frog   289 TADSVLSPASPEVSSVCERLTNEKLLKKARIHPFHIL---VALETYKK---------GHGNRGKL 341

  Fly   422 KFQCATTSFQKASFLHSVYEISFGLNKALGRR----LHITLNLEQAYLGKYLSGPCRSLKYLDAL 482
            :: ....|..:|  |.|.:..||.|.:..|:|    :.::.::.|..||..|:....:.. :..|
 Frog   342 RW-IPDPSIVEA--LDSAFYKSFKLVEPTGKRFLLAIDVSASMHQRVLGSILNASAVAAA-MCML 402

  Fly   483 VA--------LGFGYFRSDRKVTVE-FWHDRSGKLKALP-----------WTNEMSVSEAKTCCE 527
            ||        :.|........::|. ..|:...|:.|:|           |..|.:.:.      
 Frog   403 VARTEKDSHMVAFSDTMLPCPISVNMLLHEVIEKMSAIPMGATDCALPMLWAQETNTAA------ 461

  Fly   528 NQKVGKVRQSLNEILFRALLDMQNTFDVFLVLVPGAARGNPENNSKCL--AALMDKYREKRNSNA 590
                                      |:|:|..      :.|.|.:.:  |..:.:||||....|
 Frog   462 --------------------------DIFIVFT------DCETNVEDVHPATALKQYREKMGIPA 494

  Fly   591 KFIMVSLRQRQRSMIYSSGRNENLLELCSLDKHTPRLINAF 631
            |.|:.::.....|:.....|  .:|::|..|.....:|..|
 Frog   495 KLIVCAMTSNGFSIADPDDR--GMLDICGFDSGALDVIRNF 533

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10803NP_570064.1 TROVE <197..394 CDD:283406 55/224 (25%)
trove2XP_002939107.1 TROVE 16..369 CDD:283406 95/402 (24%)
vWFA 368..>482 CDD:294047 23/153 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C191423619
eggNOG 1 0.900 E1_KOG4465
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5093
OMA 1 1.010
OrthoDB 1 1.010 D223041at33208
OrthoFinder 1 1.000 FOG0006534
OrthoInspector 1 1.000 T1061563
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2766
TreeFam 1 0.960
1110.800

Return to query results.
Submit another query.