DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dnc and Pde7a

Sequence 1:NP_726846.1 Gene:dnc FlyBaseID:FBgn0000479 Length:1209 Species:Drosophila melanogaster
Sequence 2:NP_112342.1 Gene:Pde7a RGDID:68391 Length:482 Species:Rattus norvegicus

Alignment Length:478 Identity:133/479 (28%)
Similarity:216/479 (45%) Gaps:71/479 (15%)


  Fly   626 VPASNKSRRP--NQSSSASRSGNPPGAPLSQGEEAYTRLATDTIEELDWCLDQLETIQTHRSVSD 688
            ||....|||.  :.|||::..|.|....|||...|   ::.|:                    ||
  Rat    16 VPQHVLSRRGAISFSSSSALFGCPHPRQLSQRRGA---ISYDS--------------------SD 57

  Fly   689 MASLKFKRMLN----KELSHFSESSRSGNQISEYICSTFLDKQQEFDLPSLRVEDNPELVAANAA 749
            ..:| :.|||.    :..:.| |:.|.|:.  .||.......|.|.:..          |:|...
  Rat    58 QTAL-YIRMLGDVRVRSRAGF-ETERRGSH--PYIDFRIFHAQSEIEAS----------VSARNI 108

  Fly   750 AGQQSAGQYAR-SRSPRGPPMSQISGVKRPLSHTNSFTGERLPTFGVETPRENELGTLLGELDTW 813
            ....|..:|.| ||..||..:.:...:                   ::.....:...:|.::..|
  Rat   109 RRLLSFQRYLRSSRFFRGATVCRSLNI-------------------LDEDYNGQAKCMLEKVGNW 154

  Fly   814 GIQIFSIGEFSVNRPLTCVAYTIFQSRELLTSLMIPPKTFLNFMSTLEDHYVKDNPFHNSLHAAD 878
            ...||.....:....|..:.:.:|....|:....:.......|:..:::.|...||:||::||||
  Rat   155 NFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMVKLRRFLVMIQEDYHSQNPYHNAVHAAD 219

  Fly   879 VTQSTNVLLNTPALEGVFTPLEVGGALFAACIHDVDHPGLTNQFLVNSSSELALMYNDESVLENH 943
            |||:.:..|..|.|....||.::..:|.||..||:||||:...||:.::..||.:|.:.||||||
  Rat   220 VTQAMHCYLKEPKLANSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENH 284

  Fly   944 HLAVAFKLLQNQGCDIFCNMQKKQRQTLRKMVIDIVLSTDMSKHMSLLADLKTMVETKKVAGSGV 1008
            |...|..||:..|  :|.::..:.|..:...:..::|:||:|:....|:..::.::      .|.
  Rat   285 HWRSAVGLLRESG--LFSHLPLESRHEMEAQIGALILATDISRQNEYLSLFRSHLD------KGD 341

  Fly  1009 LLLDNYTDRIQVLENLVHCADLSNPTKPLPLYKRWVALLMEEFFLQGDKERESGMDISPMCDRHN 1073
            |.||:...|..||:..:.|||:.||.:...|.|:|...:.||||.|||.|::..:.:||:|||..
  Rat   342 LHLDDGRHRHLVLQMALKCADICNPCRNWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRQT 406

  Fly  1074 ATIEKSQVGFIDYIVHPLWETWA 1096
            .:|...|:||:.|:|.||:..||
  Rat   407 ESIANIQIGFMTYLVEPLFTEWA 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dncNP_726846.1 PDEase_I 870..1111 CDD:278654 84/228 (37%)
Pde7aNP_112342.1 Endonuc-BglII <51..128 CDD:286304 24/111 (22%)
PDEase_I 211..431 CDD:278654 84/228 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.