DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: kirre and NPHS1

Sequence 1:NP_001245505.1 Gene:kirre FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_004637.1 Gene:NPHS1 HGNCID:7908 Length:1241 Species:Homo sapiens

Alignment Length:685 Identity:151/686 (22%)
Similarity:235/686 (34%) Gaps:217/686 (32%)


  Fly    65 ASSANDESKPKGGDNGGQHFAMEPQDQTAVVGSRVTLPCRVMEKVGALQWTKDDFGLGQHRNLSG 129
            |..|...|.|:|       |...|::.|.|.|:.|.|.|.|.....|:||.||...||....:.|
Human    22 AQLAIPASVPRG-------FWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPG 79

  Fly   130 FERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPE------- 187
            |.||.:.|....|:|.|.|....|.|||:|:||||....|.:.:..|.. |::||||:       
Human    80 FPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVI-LSILVPPKLLLLTPE 143

  Fly   188 ------------------------APKIT----------------QGDY--LVTTE--------- 201
                                    ||.||                :|..  |.|.|         
Human   144 AGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRS 208

  Fly   202 -------------------------------------------------DREIELECVSQGGKPA 217
                                                             .:.:||.||::||.|.
Human   209 SDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRAGQSLELPCVARGGNPL 273

  Fly   218 AEITWIDGLGNVLTK-GIEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADRTYRSA 281
            |.:.|:.....|.|. |.|:.        :..|||:|.:..:.|.|....:|:|.|:.....:..
Human   274 ATLQWLKNGQPVSTAWGTEHT--------QAVARSVLVMTVRPEDHGAQLSCEAHNSVSAGTQEH 330

  Fly   282 KLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFIN------------D 334
            .:.|:|.:.|..|: ::|.|    ...|...|.|||.:.::...:..||::.            |
Human   331 GITLQVTFPPSAII-ILGSA----SQTENKNVTLSCVSKSSRPRVLLRWWLGWRQLLPMEETVMD 390

  Fly   335 ELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKK---LDISF--------GPVFRQRP 388
            .|..|..:...:.....|:.:...:.||..:.....|..||   |::.:        ||     |
Human   391 GLHGGHISMSNLTFLARREDNGLTLTCEAFSEAFTKETFKKSLILNVKYPAQKLWIEGP-----P 450

  Fly   389 VSVEADLGATVSMRC-DVAGNPEPEIEWISENSDQVVGVAAELKLKVSS--------ETAGRYFC 444
            ...:...|..|.:.| .:.|||||.:.|..::.     ...|.:|...|        |.:|..|.
Human   451 EGQKLRAGTRVRLVCLAIGGNPEPSLMWYKDSR-----TVTESRLPQESRRVHLGSVEKSGSTFS 510

  Fly   445 K--AVVNGFPEIGAEATLYVKRAPIITSHKVQFGGV-------------GGRVKIDCLAFSIPKA 494
            :  .:|.|..:..|:.|....:....|...|||...             |..:.:.|::.|....
Human   511 RELVLVTGPSDNQAKFTCKAGQLSASTQLAVQFPPTNVTILANASALRPGDALNLTCVSVSSNPP 575

  Fly   495 EHILWSFEGKIINMSSADPDIYIFEEHHLPEGVRAA--LIIRDSKATHFGKYNC---------TV 548
            .::.|..||:.:...:|.|....|      :|..||  ::::.|...|..:..|         ||
Human   576 VNLSWDKEGERLEGVAAPPRRAPF------KGSAAARSVLLQVSSRDHGQRVTCRAHSAELRETV 634

  Fly   549 MNSY-----------GGDSLVITLLREPGN--IPV 570
            .:.|           |...||:|.: |.|.  :||
Human   635 SSFYRLNVLYRPEFLGEQVLVVTAV-EQGEALLPV 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kirreNP_001245505.1 Ig 87..183 CDD:299845 36/96 (38%)
IG_like 88..182 CDD:214653 36/94 (38%)
C2-set_2 189..279 CDD:285423 29/167 (17%)
Ig_2 307..379 CDD:290606 17/87 (20%)
I-set 382..462 CDD:254352 21/91 (23%)
IGc2 396..446 CDD:197706 15/61 (25%)
Ig 466..561 CDD:299845 26/130 (20%)
IG_like 478..561 CDD:214653 22/118 (19%)
NPHS1NP_004637.1 V-set 38..119 CDD:284989 33/81 (41%)
IG_like 38..113 CDD:214653 31/75 (41%)
C2-set_2 141..228 CDD:285423 8/87 (9%)
Ig 240..321 CDD:299845 21/89 (24%)
IG_like 254..336 CDD:214653 23/90 (26%)
Ig 345..424 CDD:299845 15/83 (18%)
Ig 445..530 CDD:299845 22/95 (23%)
I-set 446..541 CDD:254352 23/105 (22%)
Ig 549..632 CDD:299845 15/89 (17%)
IG_like 558..642 CDD:214653 18/90 (20%)
I-set 646..736 CDD:254352 8/25 (32%)
Ig 662..736 CDD:299845 3/8 (38%)
Ig_3 739..820 CDD:290638
IG_like 748..821 CDD:214653
Ig8_hNephrin_like 834..942 CDD:143250
IG_like 845..935 CDD:214653
fn3 942..1023 CDD:278470
Binds to NPHS2 1160..1241
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D141865at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.