DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rst and igsf9bb

Sequence 1:NP_001284835.1 Gene:rst FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:XP_009293693.1 Gene:igsf9bb ZFINID:ZDB-GENE-091112-15 Length:1439 Species:Danio rerio

Alignment Length:945 Identity:196/946 (21%)
Similarity:323/946 (34%) Gaps:266/946 (28%)


  Fly    10 LATIVGMVRSSPYTSYQNQR-FAMEPQDQTAVVGARVTLPCRVIN----KQGTLQWTKDDFGLGT 69
            :||::..|.|:..|:.|... ...|||..|:..|..|.|.|.|::    :...::|.|  ||:..
Zfish     5 VATLIASVFSTRGTAAQGAHGVREEPQFVTSRAGETVILGCDVVHPLNGQPYVVEWFK--FGVPI 67

  Fly    70 SRDLSGFERYAMVGSDE-------EGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRS-TFAGL 126
            ...:: |..|......|       .|..||.|..|..:|...|:|:|....:......: ::..|
Zfish    68 PFFIN-FRFYPPHVDPEYAGRASLHGKSSLRIERVRSEDQGWYECKVLMLEQQYHTFHNGSWVHL 131

  Fly   127 TVLVPPEAPKITQGDVIYATEDRKVEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTV------- 184
            ||..||.... |....:.|.|...:.:.|.:. |.|...::|:.. ||.:.|:.:|.|       
Zfish   132 TVNAPPTFTD-TPPQYVEAKEGGSITLSCTAF-GNPKPSVSWLRE-GNPVQDSTKYKVSDGSLTL 193

  Fly   185 --IPLPDQRRFTAKSVLR-----------------LTPKKEHHNTN------FSCQAQ---NTAD 221
              |...|:..:|.::...                 :....|:...|      |:|||:   ....
Zfish   194 VSISREDRGAYTCRAYSEQGEAVHTTRLLVQGPPFIVSPPENITVNISQDAFFTCQAEAYPGNLT 258

  Fly   222 RTYRSAKIRVEVKYAPKVKVNVM--GSL------PGGAG-------GSVGGAGGGSVHMST--GS 269
            .|:...:..|..|...|.:|:::  |||      |..||       .|:|.....|.:::.  .:
Zfish   259 YTWFWEEDNVFFKNDLKRRVSILIDGSLIISQVKPEDAGKYTCSPSNSLGRPPSASAYLTVHYPA 323

  Fly   270 RIVEHSQV---------RLECRADANPSDVRYRWFINDEPI-----IGGQKTEMVIRNVTRKFHD 320
            |::....|         .:.|..||||.....:|..:..|:     .|..:.|.....|:....|
Zfish   324 RVINMPPVIYVAIGLPGYIRCPVDANPPVTSVKWKKDGLPLRIEKYPGWSQMEDGSIRVSEVTED 388

  Fly   321 AI--VKCEVQNSVGKSEDS--ETLDISYAPSFRQRP-QSMEADVGSVVSLTCEVDSNPQPEIVW- 379
            ::  ..|...||:|....|  ..|.:...|.|...| .....:.|..:.:.||.:.:|.|.|.| 
Zfish   389 SLGTYTCVPYNSLGTMGPSPPAPLVLKDPPKFLVVPGGEYRQEAGRELVIPCEAEGDPFPNITWR 453

  Fly   380 --IQHP--SDRVVGTSTNLTF-SVSNETAGRYYCKA-NVPGYAEISADAYVYLKG-SPAIGSQRT 437
              :..|  |...|....:|.| |:|.|..|.:.|.| ||.  ..|:|..::.:.| ||..     
Zfish   454 KKVGKPSRSKHNVLPRGSLQFKSLSKEDHGEWECVASNVA--TSITASTHLLVIGTSPHA----- 511

  Fly   438 QYGLVGDTARIECFASSVPRARHVSW----------TFN---GQEISSE--SGHDYSILVDAVPG 487
                   .|::....|:.  :.:|||          ||:   |..:..|  ..||:  |...||.
Zfish   512 -------PAKVHVTVSTT--SANVSWDSSYDGGFEQTFSVWYGHVVKREQLGPHDW--LSMPVPS 565

  Fly   488 GVKSTLI--IRDSQAYHYGKYNCTVVNDYG----NDVAEIQLQAKKSVSLLMTIVGGISVVAFLL 546
            |....|:  :....||   :::....|..|    ::|..:.           |:|..||....|:
Zfish   566 GQHWLLVQGLEPETAY---QFSVLAQNKLGTGPFSEVVTVN-----------TLVFPISTPEPLV 616

  Fly   547 VLTILVVVYIKCKKRTKLPPADVISEHQITKNGGVSCKLEPGDRTS---NY-SDLKV----DISG 603
            :||               ||..:.:..  |:.|.:...:.|.:.||   :| .|.::    |:..
Zfish   617 LLT---------------PPRCLTANR--TQQGVLLTWIPPANHTSPIDHYIMDFRLGERWDVLD 664

  Fly   604 GYVPYGD-----------------------------------YSTHYSPPPQ------------- 620
            ..:|.|:                                   .||.|.|||:             
Zfish   665 DAIPAGETEILARDLIQEAWYEFRVMAVMEDLVSEPSNVVGVSSTDYFPPPEVPDEGLARPVVAG 729

  Fly   621 ------YLTTCSTKSNGSSTIMQNNHQNQLQLQQQQQQS--HHQHHTQTTTLPMTFLTNSSGGSL 677
                  :|......|..::..:....:.:|:.::....|  |.:...:|        .:|||...
Zfish   730 IVATICFLAAAILFSTLAACFVNKQRRRKLKRRRDPPLSITHCRKSVET--------PSSSGKIS 786

  Fly   678 TGSI--IGSREIRQDNGLP-------------SLQSTTASVVSSSPNGSCSNQSTTAATTTT--- 724
            ..||  ||......::||.             ||...|...:.|. ..|.|.....|.|...   
Zfish   787 PESIRSIGPPSESSEDGLRAKKFPQSPAKEELSLYKKTKRAIISK-KYSVSKHEAEATTPIELIS 850

  Fly   725 -----THVVVPSSMALSVDPRYSAIYGNPYLRSSN 754
                 ..|:.|:.|...|..|  .|.|.|::..|:
Zfish   851 RGPDGRFVMDPTDMETPVKAR--RIEGFPFVEESD 883

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 27/108 (25%)
Ig 42..114 CDD:299845 21/83 (25%)
C2-set_2 135..225 CDD:285423 22/125 (18%)
Ig_3 265..329 CDD:290638 14/82 (17%)
I-set 346..420 CDD:254352 24/82 (29%)
Ig 360..425 CDD:299845 22/72 (31%)
Ig5_KIRREL3-like 428..524 CDD:143235 24/118 (20%)
IG_like 435..524 CDD:214653 21/110 (19%)
igsf9bbXP_009293693.1 IG_like 30..113 CDD:214653 23/86 (27%)
Ig 41..113 CDD:143165 19/75 (25%)
IG_like 144..223 CDD:214653 14/81 (17%)
IGc2 151..208 CDD:197706 13/59 (22%)
I-set 227..319 CDD:254352 20/92 (22%)
Ig <263..319 CDD:299845 13/56 (23%)
Ig_2 326..414 CDD:290606 18/88 (20%)
IG_like 329..403 CDD:214653 16/74 (22%)
IG_like 424..504 CDD:214653 23/82 (28%)
Ig 440..504 CDD:299845 21/66 (32%)
FN3 509..604 CDD:238020 22/125 (18%)
FN3 620..704 CDD:238020 12/86 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.