DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rst and igsf9b

Sequence 1:NP_001284835.1 Gene:rst FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:XP_686205.6 Gene:igsf9b ZFINID:ZDB-GENE-060810-28 Length:2021 Species:Danio rerio

Alignment Length:897 Identity:175/898 (19%)
Similarity:282/898 (31%) Gaps:288/898 (32%)


  Fly    40 VVGARVTLPCRVI-NKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLDDDA 103
            ::|..:||.|... |.:.|:.|.|         .||..|:...:....|   :|.:..|..:...
Zfish   154 LLGESLTLHCDAHGNPKPTIIWRK---------YLSAAEKQEEIQVLNE---TLSLSKVTRETAG 206

  Fly   104 RYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVE------IECVSVGGKP 162
            .|:|.|| ..||. ...||  .|.|..||        .:|.|.||..:.      ::|.:.....
Zfish   207 IYKCHVS-NSEGN-LTHST--QLQV
KGPP--------IIIIAPEDTTMNMSQDAVLQCQAEAYPS 259

  Fly   163 AAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQN-----TADR 222
            .....|.....||      |.:..|..:.:......|.::......:.|::|:..|     .|..
Zfish   260 NLTYEWWKQGQNV------YHIEILKSRVKILVDGTLLISALIPDDSGNYTCRPTNGLMTPPAAS 318

  Fly   223 TYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANP 287
            .|.:.|....|...|:...     ||.|.||                        ::.|...|.|
Zfish   319 AYLTV
KHPARVVRMPRETY-----LPMGMGG------------------------KIPCPVQAEP 354

  Fly   288 SDVRYRW-----FINDEPIIGGQKTEMVIRNVTRKFHDAI--VKCEVQNS---VGKSEDSETLDI 342
            ..:...|     .:|.|...|..........:|....||:  ..|...||   :|:||.::.: :
Zfish   355 PMLYVNWTKDGASLNLEQYPGWMVNSEGSVFITAANDDAVGMYTCTAYNSYGTMGQSEPTKVI-L 418

  Fly   343 SYAPSFRQRPQS-MEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTFSV-------- 398
            ...||||..|:: ...:||..:.:.|:...:|.|.|.||:      ||.:....|:|        
Zfish   419 KDPPSFRVSPRAEYLQEVGRDLVIPCQSQGDPSPNITWIK------VGPAPRSPFTVLSNGSLFL 477

  Fly   399 ---SNETAGRYYCKANVPGYAEISADAYVYLKGS-----------PAIGSQRTQY--GLVGD-TA 446
               |.:..|.:.|.|: ...|.:|....:.:.|:           |.||.....:  |..|. |.
Zfish   478 RPLSKDHQGTWECLAS-NRVATVSVATTILVLGTSPHAVTSVSVDPGIGQANVSWEAGFDGGYTQ 541

  Fly   447 RIECFASSVPRARHVSWTFNGQEISSES----------GHDYSILVDAVPGG------------- 488
            |...:.....|.:| .|.......|..|          .:.:|:|.....|.             
Zfish   542 RFTVWVKPTVRGKH-EWASIPVPTSKTSLLVTSLQPATSYQFSVLAQNKLGSGPFSEIVTIKTLA 605

  Fly   489 -------VKSTL----------------------------------------------------- 493
                   |.:|:                                                     
Zfish   606 PPTESPTVLTTMAVLSPPTLLSANRTSLGVLLQWVPPLEESLTSFALQAKRGKGEWVTIDREIAV 670

  Fly   494 ---------IIRDSQAYHYGKYNC-----------TVVNDYGNDV--AEIQLQAKKSVSLLMTIV 536
                     :::||: |.....:|           .:::..|.::  |...|.|.....||..::
Zfish   671 NMTELIVQGLVKDSK-YELRLLSCQDKLVSVPSDSVLISTEGMEMYPAAPSLLAFVPEPLLAGVI 734

  Fly   537 GGIS--VVAFLLVLTILVVVYIKCKKRTKLPPADVISEHQITKNGGVSCKLEPGDRTSNYSDLKV 599
            ||:.  .||.:|.|....|:..|.::|.:....|:.|..|  |:...... .|.|...:...||:
Zfish   735 GGVCFLFVAIILSLVTACVMNSKRRQRRQKKRDDIPSAFQ--KSSAPQAN-SPSDSPDSLLKLKL 796

  Fly   600 DISGGYVPYGDYSTHYSPPPQYLTTCSTKSNGSSTIMQNNHQNQLQLQQQQ---QQSHHQHHTQT 661
                            .||..:....|:......:......:::.|.|::|   ..|...|:|| 
Zfish   797 ----------------CPPLNFFPNSSSSDRSDRSSFDKASRSEYQDQKKQLLSSSSPPPHYTQ- 844

  Fly   662 TTLPMTFLTNSSGG---------SLTGSIIGSREIRQD--NGLPSL-----QSTTASVVSSSPNG 710
                   ..:..||         |::.|..|...|:.|  |...:|     ||.:......|.||
Zfish   845 -------FESHFGGTPSPTPAIESISRSPDGRFIIQPDLENFKKNLKKEFPQSPSRGSGRGSSNG 902

  Fly   711 SC--SNQSTTAATTTTTHVVVPSSMALSVDPRYSAIYGNPYLRSSNSSLLPP 760
            |.  ||||.:|.:.|.....:||  ||:||        :|:|..      ||
Zfish   903 SFKESNQSNSARSETNAQTEMPS--ALTVD--------HPHLER------PP 938

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 24/91 (26%)
Ig 42..114 CDD:299845 18/73 (25%)
C2-set_2 135..225 CDD:285423 16/101 (16%)
Ig_3 265..329 CDD:290638 11/71 (15%)
I-set 346..420 CDD:254352 23/86 (27%)
Ig 360..425 CDD:299845 17/76 (22%)
Ig5_KIRREL3-like 428..524 CDD:143235 25/215 (12%)
IG_like 435..524 CDD:214653 21/197 (11%)
igsf9bXP_686205.6 Ig 27..132 CDD:299845
IG_like 148..227 CDD:214653 23/89 (26%)
IGc2 156..217 CDD:197706 19/74 (26%)
Ig 237..323 CDD:299845 14/92 (15%)
IG_like 237..323 CDD:214653 14/92 (15%)
Ig 345..411 CDD:143165 14/66 (21%)
IG_like 435..507 CDD:214653 18/79 (23%)
IGc2 437..496 CDD:197706 15/66 (23%)
FN3 512..603 CDD:238020 15/92 (16%)
FN3 621..709 CDD:238020 4/89 (4%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.