DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rst and Nphs1

Sequence 1:NP_001284835.1 Gene:rst FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_062332.2 Gene:Nphs1 MGIID:1859637 Length:1256 Species:Mus musculus

Alignment Length:658 Identity:149/659 (23%)
Similarity:245/659 (37%) Gaps:148/659 (22%)


  Fly     3 HTMQLLLLATIVGMVRSSPYTSYQNQRFAMEPQDQTAVVGARVTLPCRVINKQGTLQWTKDDFGL 67
            |.:.|||...:...:..||..:...:.|....::.|.|.|:.|.|.|.|......:||.||...|
Mouse    21 HLIPLLLAGMLTTGLAQSPVPTSAPRGFWALSENLTVVEGSTVKLWCGVRAPGSVVQWAKDGLLL 85

  Fly    68 GTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPP 132
            |.:..:.||.||::.|...:|::.|.|....|.|||.|:|||.....| |.:.|....|::||.|
Mouse    86 GPNPKIPGFPRYSLEGDSAKGEFHLLIEACDLSDDAEYECQVGRSELG-PELVSPSVILSILVSP 149

  Fly   133 EAPKIT--QGDVIYATEDRKVEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTA 195
            :..::|  .|..:.....::..:.|||...|||.:|.:|.| |..:.| :..:|....:::.|..
Mouse   150 KVLQLTPEAGSTVTWVAGQEYVVTCVSGDAKPAPDIIFIQG-GRTVED-VSSSVNEGSEEKLFFT 212

  Fly   196 KSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGG 260
            ::..|:||:...:.....|:..|.|..|...|...:.:.:.|...|             :...|.
Mouse   213 EAEARVTPQSSDNGQLLVCEGSNPALATPIKASFTMNILFPPGPPV-------------IDWPGL 264

  Fly   261 GSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTE--------MVIRNVTRK 317
            ...|:..|..:      .|.|.|.........:|..|.:|:.....||        :::..|..:
Mouse   265 NEGHVRAGENL------ELPCIARGGNPPATLQWLKNGKPVSIAWGTEHAQAVAHSVLVMTVRPE 323

  Fly   318 FHDAIVKCEVQNSVG--KSEDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIV-- 378
            .|.|.:.|:..|||.  ..|.|.||.:::.||......|........|:|.|...|: :|.::  
Mouse   324 DHGARLSCQSYNSVSAETQERSITLQVTFPPSAVTILGSTSQSENKNVTLCCLTKSS-RPRVLLR 387

  Fly   379 -WIQH----PSDRVVG--------TSTNLTFSVSNETAG-RYYCKANVPGYAEISADAY------ 423
             |:..    |:|..|.        :.:|||..|..|..| ...|:|        .:||:      
Mouse   388 WWLGGRQLLPTDETVMDGLHGGHISMSNLTLLVKREDNGLSLTCEA--------FSDAFSKETFK 444

  Fly   424 -------------VYLKGSPAIGSQRTQYGLVGDTARIECFASSVPRARHVSWTFNGQEIS---- 471
                         ::::|.|...|.||     |...|:.|.|........::|..:.:.::    
Mouse   445 KSLTLNVKYPAQKLWIEGPPEGQSIRT-----GTRVRLVCLAIGGNPEPSLTWLKDSRPVNDPRQ 504

  Fly   472 ------------SESGHDYS---ILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEI 521
                        .:||..:|   :|:...|..:              .|::|..    |...|..
Mouse   505 SQEPRRVQLGSVEKSGSTFSRELVLIIGPPDNL--------------AKFSCKA----GQLSAST 551

  Fly   522 QLQAKKSVSLLMTIVGGISVVAFLLV-LTILVVVYIKCKKRTKLPPADVISEH--QITKNGGVSC 583
            ||                 ||.|... ||||.       ..:.|.|.|.::..  .|:.|..|:.
Mouse   552 QL-----------------VVQFPPTNLTILA-------NSSALRPGDALNLTCVSISSNPPVNL 592

  Fly   584 KLE-PGDR 590
            .|: .|:|
Mouse   593 SLDKEGER 600

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 34/96 (35%)
Ig 42..114 CDD:299845 27/72 (38%)
C2-set_2 135..225 CDD:285423 22/92 (24%)
Ig_3 265..329 CDD:290638 13/72 (18%)
I-set 346..420 CDD:254352 20/90 (22%)
Ig 360..425 CDD:299845 19/100 (19%)
Ig5_KIRREL3-like 428..524 CDD:143235 21/115 (18%)
IG_like 435..524 CDD:214653 18/108 (17%)
Nphs1NP_062332.2 Ig 52..128 CDD:299845 29/76 (38%)
IG_like 52..127 CDD:214653 28/75 (37%)
C2-set_2 155..242 CDD:285423 22/89 (25%)
Ig 254..332 CDD:299845 17/97 (18%)
IG_like 268..350 CDD:214653 21/88 (24%)
C2-set_2 358..440 CDD:285423 20/91 (22%)
Ig 459..544 CDD:299845 17/104 (16%)
I-set 460..555 CDD:254352 22/135 (16%)
Ig 563..646 CDD:299845 12/46 (26%)
IG_like 670..750 CDD:214653
Ig 676..750 CDD:299845
Ig_3 753..834 CDD:290638
IG_like 762..848 CDD:214653
Ig 848..956 CDD:299845
IG_like 859..949 CDD:214653
fn3 956..1039 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D141865at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.