DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rst and NPHS1

Sequence 1:NP_001284835.1 Gene:rst FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_004637.1 Gene:NPHS1 HGNCID:7908 Length:1241 Species:Homo sapiens

Alignment Length:840 Identity:199/841 (24%)
Similarity:290/841 (34%) Gaps:231/841 (27%)


  Fly    25 YQNQRFAME--PQDQTAVVGARVTLPCRVI--NKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSD 85
            |..|:..:|  |:.|....|.||.|.|..|  |.:.:|.|.||...:..|| |....|...:||.
Human   439 YPAQKLWIEGPPEGQKLRAGTRVRLVCLAIGGNPEPSLMWYKDSRTVTESR-LPQESRRVHLGSV 502

  Fly    86 EEGDYSLDIYPVML----DDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPP-------EAPKITQ 139
            |:...:.....|::    |:.|::.|:.     ||   .|....|.|..||       .|..:..
Human   503 EKSGSTFSRELVLVTGPSDNQAKFTCKA-----GQ---LSASTQLAVQFPPTNVTILANASALRP 559

  Fly   140 GDVIYATEDRKVEIECVSVGGKPAAEITWIDGLGNVLTDNIEYTVIP---LPDQRRFTAKSVLRL 201
            ||.:..|        ||||...|...::| |..|    :.:|....|   .|.:....|:||| |
Human   560 GDALNLT--------CVSVSSNPPVNLSW-DKEG----ERLEGVAAPPRRAPFKGSAAARSVL-L 610

  Fly   202 TPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMS 266
            ......|....:|:|.:...|...|:..|:.|.|.|:..                   |..|.:.
Human   611 QVSSRDHGQRVTCRAHSAELRETVSSFYRLNVLYRPEFL-------------------GEQVLVV 656

  Fly   267 TGSRIVEHSQVRLECRADANPSDVRYRWFINDEPI--IGGQKTEMV------IRNVTRKFHDAIV 323
            |.   ||..:..|.....|||:...:.|......:  .||.:..::      :.||||. .|.:.
Human   657 TA---VEQGEALLPVSVSANPAPEAFNWTFRGYRLSPAGGPRHRILSSGALHLWNVTRA-DDGLY 717

  Fly   324 KCEVQNSVGKSEDSETLDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNP-QPEIV-WIQHPSDR 386
            :...|||.|.:|....||:.|||:.|......|.:||..|.:.|.||:|| .|.:. |.:...|.
Human   718 QLHCQNSEGTAEARLRLDVHYAPTIRALQDPTEVNVGGSVDIVCTVDANPILPGMFNWERLGEDE 782

  Fly   387 VVGTSTNLTFSVSNETAGR---YYCKANVPGYAEISADAYV----------YLKGSPAI--GSQR 436
            ...:..::. .:|....||   ::.|....|..:...|..|          .::.:|.:  .:..
Human   783 EDQSLDDME-KISRGPTGRLRIHHAKLAQAGAYQCIVDNGVAPPARRLLRLVVRFAPQVEHPTPL 846

  Fly   437 TQYGLVGD---TARIECFASSVPRARHVSWTFNGQEISSE----SGHDYSILVDAVPGGVKSTL- 493
            |:....||   :|.:.|.|..||.. ..:||.||..:..:    :.|.|.      .|||.|:| 
Human   847 TKVAAAGDSTSSATLHCRARGVPNI-VFTWTKNGVPLDLQDPRYTEHTYH------QGGVHSSLL 904

  Fly   494 -IIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLM-TIVGGISVVAFLLVLTILVVVYI 556
             |...|.|..|..:.||..|..|:|...|||     ||:.. ....|:.||:             
Human   905 TIANVSAAQDYALFTCTATNALGSDQTNIQL-----VSISRPDPPSGLKVVS------------- 951

  Fly   557 KCKKRTKLPPADVISEHQITKNGGVSCKLEPGDRTSNYSDLKVDISGG--------YVPYGDYST 613
                         ::.|.:    |:..|  ||            ..||        |...|....
Human   952 -------------LTPHSV----GLEWK--PG------------FDGGLPQRFCIRYEALGTPGF 985

  Fly   614 HYSP--PPQYLTTCST-------------KSN--GSSTIMQNNHQNQLQ---LQQQQQQSHHQHH 658
            ||..  |||..|...|             .||  |.|.:.....|..:.   |.|...:...|..
Human   986 HYVDVVPPQATTFTLTGLQPSTRYRVWLLASNALGDSGLADKGTQLPITTPGLHQPSGEPEDQLP 1050

  Fly   659 TQTTT-------LPMTF----LTNSSGGSLTGSIIGSREIRQ-DNGLPSLQSTTA---------S 702
            |:..:       ||:.|    |...|..|..|.::..|.:|: ..|:.  :.|.|         .
Human  1051 TEPPSGPSGLPLLPVLFALGGLLLLSNASCVGGVLWQRRLRRLAEGIS--EKTEAGSEEDRVRNE 1113

  Fly   703 VVSSSPNGSCSNQSTTAATTTTTHVVVPSSMALSVDPRYSAIYGNPYLRSSN--SSLLPP 760
            ...|...|....||:|.:||.                      ..||.||..  |..|||
Human  1114 YEESQWTGERDTQSSTVSTTE----------------------AEPYYRSLRDFSPQLPP 1151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 29/102 (28%)
Ig 42..114 CDD:299845 22/78 (28%)
C2-set_2 135..225 CDD:285423 23/93 (25%)
Ig_3 265..329 CDD:290638 16/72 (22%)
I-set 346..420 CDD:254352 19/79 (24%)
Ig 360..425 CDD:299845 17/80 (21%)
Ig5_KIRREL3-like 428..524 CDD:143235 32/107 (30%)
IG_like 435..524 CDD:214653 31/98 (32%)
NPHS1NP_004637.1 V-set 38..119 CDD:284989
IG_like 38..113 CDD:214653
C2-set_2 141..228 CDD:285423
Ig 240..321 CDD:299845
IG_like 254..336 CDD:214653
Ig 345..424 CDD:299845
Ig 445..530 CDD:299845 25/86 (29%)
I-set 446..541 CDD:254352 29/104 (28%)
Ig 549..632 CDD:299845 24/97 (25%)
IG_like 558..642 CDD:214653 25/98 (26%)
I-set 646..736 CDD:254352 25/113 (22%)
Ig 662..736 CDD:299845 19/75 (25%)
Ig_3 739..820 CDD:290638 21/82 (26%)
IG_like 748..821 CDD:214653 18/74 (24%)
Ig8_hNephrin_like 834..942 CDD:143250 34/120 (28%)
IG_like 845..935 CDD:214653 30/97 (31%)
fn3 942..1023 CDD:278470 23/125 (18%)
Binds to NPHS2 1160..1241
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D141865at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.