DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rst and nrm

Sequence 1:NP_001284835.1 Gene:rst FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001246890.1 Gene:nrm FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster

Alignment Length:898 Identity:174/899 (19%)
Similarity:303/899 (34%) Gaps:235/899 (26%)


  Fly     8 LLLATIVGMVRSSPYTSYQNQRFAMEPQDQTAVVGARVTLPCRV----INKQGTLQWTKDD---- 64
            |:|...:.:|.||   :.|......:.:.|:      |.|||.|    ..|..:|.|.|.|    
  Fly    29 LVLVLCLALVDSS---TAQVDTTISQQESQS------VVLPCPVDAEKCGKLHSLNWFKGDDRIA 84

  Fly    65 -FGLGTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPG-PEGQPAIRSTFAG-- 125
             ..||.|...|..:.:....:.|:..|.|.|..:.:.|:..|.|..:.. ||   .....|.|  
  Fly    85 AMLLGDSNVTSVNKEFDERVTVEQNPYRLVIKDLKIADEDIYLCDTTFFIPE---ETCDNFNGYR 146

  Fly   126 --LTVLVPP--------EAPKITQGDVIYATEDRK-VEIECVSVGGKPAAEITWIDGLGNVLTDN 179
              |.|||||        :..:|..|.|:...::|: ::..|.....:|..|::|..|...:.|.:
  Fly   147 IELRVLVPPTEVVILDAKGDRIKNGSVVGPMQERQSLKATCTVRNTRPQPEVSWFRGTKRLTTYS 211

  Fly   180 IEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVEVKYAP-KVKVNV 243
            ..:.::    ...:|:...|..|..:|....:..|:.::.|.:.....|..|:::..| .:.:| 
  Fly   212 PTHDLV----DGLYTSTLELDWTLSREDLAQDIECRVKSAAIQNVTVTKFSVDLQVRPTSIDIN- 271

  Fly   244 MGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTE 308
                            |...|...||::|      |.|........|...|: |...||...:.|
  Fly   272 ----------------GVKHHTVQGSKVV------LTCDIHGARPAVNLTWY-NTTTIISSGENE 313

  Fly   309 M--------------------VIRNVTRKFHDAIVKCEVQNSVGKSEDSE------TLDISYAPS 347
            :                    :|.|.||..:|.:.:||.:|.|.:....:      ||::.|.|.
  Fly   314 ITEVRSKSLEKSDGTFHTQSELIFNATRFENDRVFRCEAENIVLQINREKPISSALTLEVLYPPV 378

  Fly   348 FRQRPQSMEADVGSVVSLTCEVDSNPQ--PEIVWIQHPSDRVV----------GTSTNLTF---S 397
            .:..|.::.|:...:|.|.||..:||.  .::.|  :.:|.:|          |.|.|:..   |
  Fly   379 VKVSPSAITANTSEIVLLNCEYFANPASLTQVEW--YRNDILVNVNDTTHYKGGNSENVALVIKS 441

  Fly   398 VSNETAGRYYCK-ANVPGYAEISADAYVYLKGSPAIGSQRTQYGLV--GDTARIECFASSVPR-- 457
            ...|..|.|.|: :|..|.........:.::.:|.:.......|.|  .|.:.:..|.:.:..  
  Fly   442 TEKEDIGNYSCQLSNNIGKGTSDQKINLDVQYAPTVEILMIPEGPVKESDESNVTLFCNVLDANP 506

  Fly   458 --ARHVSWTFNG---------QEISSESGH----------------------------------D 477
              ...|.|..|.         :|...:..|                                  |
  Fly   507 SVLTKVRWYANSTLLKELPDCEETREDLCHIDPSKLLLESIGRGFFYNYSCEGFNAAGWGPRSED 571

  Fly   478 YSILVDAVPG----------GVKSTLI----------IRDSQAYHY-----GKYNCTVVNDYGND 517
            ..:||...||          .||...:          ..:|..:.:     |.....|..|:  .
  Fly   572 KELLVHYEPGPAALSHFPLVAVKKKSVTFSCSVDDPGFPESNRFRWLRGGRGPLQDIVTKDW--T 634

  Fly   518 VAEIQLQAKKSVSLLMTIVGGISVVAFLLVLTILVVVYIKCKKRTKLPPADVISEHQITKNGGVS 582
            |..:.|.::.:.|......||..|:|.:.:.......:||     .|||...|...  :.|..::
  Fly   635 VEPVGLDSRTNYSCYAYNEGGKGVMATVNLEVHAPPFFIK-----NLPPYTGILHS--SPNATLT 692

  Fly   583 CKLEPGDRTSNYSDLKVDISGGYVPYGDYSTHYSPPPQYLTTCSTKSNGSSTI------MQNNHQ 641
            |::|...|    .|:.....|  ||.....:.|....:|:.......:..|.:      |.|...
  Fly   693 CRIECVPR----CDISWQKDG--VPIERNDSRYFIKEKYMDASPATGDFESMLSVLHFNMPNWPD 751

  Fly   642 NQLQLQQQQQQSHHQHHTQTTTLPMTFLTNSSGGSLTGSIIGSREIRQDNGLPSLQSTTASVVSS 706
            ::..::...                   .|.|..| ||:|:|.          |::|.|...:..
  Fly   752 SKFNIEADN-------------------ANYSCVS-TGNIVGG----------SIRSRTYFGIEY 786

  Fly   707 SP-NGSCSNQSTTAATTTTTHVVVPSSMALSVDPRYSAIYGNPYLRSSNSSLL 758
            :| |.:.|.........|....|:..|.| :.:|.|..|:.|..:.:.|:.::
  Fly   787 APENTTVSENIVYVQEDTIPGRVICKSRA-NPEPSYKWIFKNETIANGNALII 838

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 29/110 (26%)
Ig 42..114 CDD:299845 22/82 (27%)
C2-set_2 135..225 CDD:285423 16/91 (18%)
Ig_3 265..329 CDD:290638 18/84 (21%)
I-set 346..420 CDD:254352 22/90 (24%)
Ig 360..425 CDD:299845 19/81 (23%)
Ig5_KIRREL3-like 428..524 CDD:143235 23/170 (14%)
IG_like 435..524 CDD:214653 22/163 (13%)
nrmNP_001246890.1 Ig 44..152 CDD:299845 29/117 (25%)
Ig 176..248 CDD:299845 12/76 (16%)
Ig 277..354 CDD:299845 18/84 (21%)
IG_like 383..463 CDD:214653 21/82 (26%)
Ig 394..463 CDD:143165 19/71 (27%)
Ig_3 585..652 CDD:290638 9/69 (13%)
Ig 685..>719 CDD:299845 8/42 (19%)
IG_like 788..869 CDD:214653 12/53 (23%)
Ig <811..869 CDD:299845 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11640
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.