DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rst and Dscam2

Sequence 1:NP_001284835.1 Gene:rst FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001261500.1 Gene:Dscam2 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster

Alignment Length:618 Identity:146/619 (24%)
Similarity:236/619 (38%) Gaps:123/619 (20%)


  Fly    36 DQTAVVGARVTLPCRVI-NKQGTLQWTKDDFGL-GTSRDLSGFERYAMVGSDEEGDY--SLDIYP 96
            :||...|..|:|.|... |....:.||.|.|.| ...|.:.|  :|..|    .||.  .::|..
  Fly   431 EQTLQPGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIG--QYITV----HGDVISHVNISH 489

  Fly    97 VMLDDDARYQCQVSPGPEG--QPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVG 159
            ||::|...|.| ::....|  |.|.|....||..:  ...||:|      |.....:.::| .|.
  Fly   490 VMVEDGGEYAC-IAENRAGRVQHAARLNIYGLPYI--RLIPKVT------AVSGETLNLKC-PVA 544

  Fly   160 GKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTN-FSCQAQNTADRT 223
            |.|..||.|..| |..|.|:|...|.|         ...|.::|.:::.::. ::|.|:|....:
  Fly   545 GYPIEEIHWERG-GRELPDDIRQRVQP---------DGSLTISPVQKNSDSGVYTCWARNKQGHS 599

  Fly   224 -YRSAKIRVEV--KYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADA 285
             .||.::.|.|  |.:| .:.|:: .|..|...|:           |.|.:.....:.:..|.|.
  Fly   600 ARRSGEVTVIVPPKLSP-FQTNIL-QLNMGDRASL-----------TCSVVKGDLPLTINWRKDG 651

  Fly   286 NPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFRQ 350
            .|.|......:..   :....:.:||.|:... |.....|.|:||..:.|:|:.|.::..|.:..
  Fly   652 RPIDPTQHMSVKQ---VDQYNSILVIENLGSD-HTGNYSCVVRNSAAEVENSQALLVNVPPRWIV 712

  Fly   351 RPQSMEADVGSVVSLTCEVDSNPQPEIVW--------------IQHPSDRVVGTSTNLTFSVSNE 401
            .|.....:....:.|.|:....|.|.|||              .:.|..:::|..:.|...|..:
  Fly   713 EPVDANVERNRHIMLHCQAQGVPTPSIVWKKATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKED 777

  Fly   402 TAGRYYCKANVPGYAEISADAYVYLKGSPAIGS-QRTQYGLVGDTARIECFASSVPRARHVSWTF 465
            ..|.|.|:||......|.....:.:..||...| .|:.....||||.::| |.|..:..::.|..
  Fly   778 REGFYLCQANNGIGTGIGKVIQLKVNSSPYFSSTSRSVMVKKGDTALLQC-AVSGDKPINIVWMR 841

  Fly   466 NGQE-ISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSV 529
            :|:. ::..:.:..|:..:|.|.||.:.|.||...|...|.|.|...|.||||...:|||.::  
  Fly   842 SGKNTLNPSTNYKISVKQEATPDGVSAELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQE-- 904

  Fly   530 SLLMTIVGGISVVAFLLVLTILVVVYIKCKKRTKLPPADVISEHQITKNGGVSCKLEP-----GD 589
                                            ..|||:  :.|..:..:..|:.|.:|     ||
  Fly   905 --------------------------------PPLPPS--VLEAAMISSRSVNIKWQPKTLGTGD 935

  Fly   590 RTSNYSDLKVDISGGYVPYGDYSTHYSPPPQYL 622
            .|.            |:.....:.|..||..::
  Fly   936 VTK------------YIVEFREADHSLPPALFV 956

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 30/100 (30%)
Ig 42..114 CDD:299845 22/76 (29%)
C2-set_2 135..225 CDD:285423 23/92 (25%)
Ig_3 265..329 CDD:290638 12/64 (19%)
I-set 346..420 CDD:254352 19/88 (22%)
Ig 360..425 CDD:299845 17/79 (22%)
Ig5_KIRREL3-like 428..524 CDD:143235 32/98 (33%)
IG_like 435..524 CDD:214653 29/90 (32%)
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352
Ig 247..327 CDD:299845
I-set 332..418 CDD:254352
IGc2 344..407 CDD:197706
IG_like 432..517 CDD:214653 28/92 (30%)
IGc2 436..507 CDD:197706 22/78 (28%)
I-set 521..610 CDD:254352 26/108 (24%)
IGc2 533..597 CDD:197706 19/75 (25%)
Ig 630..699 CDD:143165 16/84 (19%)
IG_like 714..802 CDD:214653 18/88 (20%)
Ig 725..802 CDD:299845 17/77 (22%)
Ig 823..894 CDD:143165 22/72 (31%)
FN3 906..1006 CDD:238020 14/66 (21%)
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.