DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rst and Kirrel3

Sequence 1:NP_001284835.1 Gene:rst FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:XP_017451106.1 Gene:Kirrel3 RGDID:1311382 Length:784 Species:Rattus norvegicus

Alignment Length:647 Identity:187/648 (29%)
Similarity:289/648 (45%) Gaps:90/648 (14%)


  Fly    30 FAMEPQDQTAVVGARVTLPCRVINKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDYSLDI 94
            |:.:||||..|.|..|||.|.:....|.:.|.||...||..||||.:.:|.:||:...|::.|.|
  Rat    56 FSQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSSYPQYLVVGNHLSGEHHLKI 120

  Fly    95 YPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVG 159
            ....|.|||.|:||..     |.||||..|.|||||||:.|.|..|.||.......:.:.|.:..
  Rat   121 LRAELQDDAVYECQAI-----QAAIRSRPARLTVLVPPDDPIILGGPVISLRAGDPLNLTCHADN 180

  Fly   160 GKPAAEITWIDGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTY 224
            .||||.|.|: ..|.|: :...|:...|.|.:|.:..|.|.::|....:..:..|:|.|.|....
  Rat   181 AKPAASIIWL-RKGEVI-NGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGG 243

  Fly   225 RSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSD 289
            :...:.:::::.|.|.::|                       ....::|.:.|...|.|.|||:.
  Rat   244 KETSVTIDIQHPPLVNLSV-----------------------EPQPVLEDNIVTFHCSAKANPAV 285

  Fly   290 VRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFRQRPQS 354
            .:|||..... ||.....|:....|...:....|.|||.|::|.:..|.|:|:.:.|.....|||
  Rat   286 TQYRWAKRGH-IIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQS 349

  Fly   355 MEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTF-SVSNETAGRYYCKANVPGYAEI 418
            :..|:||....:|....||...|||::..|..|:.....||. ||..|.||:|.|:|.||.....
  Rat   350 LLVDLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAG 414

  Fly   419 SADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSVPRARHVSWTFNGQEISSESGHDYSILVD 483
            ..:..:.:.|.|.|.|.:||:.|.|:..:|:||..|.|....::|::....:.|.:...|::...
  Rat   415 EREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGTSGRYTVETV 479

  Fly   484 AVPGGVKSTL----IIR-DSQAYHYGKYNCTVVNDYGNDVAEIQLQAK----------KSVSLLM 533
            ....||.|||    |:| |.|..    ||||..|.:|:|...|:|:.:          ::.|:.|
  Rat   480 NTEEGVISTLTISNIVRADFQTI----YNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPM 540

  Fly   534 TIVGGISV---VAFLLVLTILVVVYIKCKKRTKLPPADVIS---------------------EHQ 574
            .::.|::|   ||||:::..:|..   |..|::.....|:|                     :|.
  Rat   541 AVIIGVAVGAGVAFLVLMATIVAF---CCARSQRNLKGVVSAKNDIRVEIVHKEPASGREAEDHT 602

  Fly   575 ITK----------NGGVSCKLEP-GDRTSNYSDLKVDISGGYVPYGDYSTHYSPPPQYLTTC 625
            ..|          ...|..:||. .:....:.:|| |.:.||.....:..|:|.|...|::|
  Rat   603 TIKQLMMDRGEFQQDSVLKQLEVLKEEEKEFQNLK-DPTNGYYSVNTFKEHHSTPTISLSSC 663

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 43/96 (45%)
Ig 42..114 CDD:299845 28/72 (39%)
C2-set_2 135..225 CDD:285423 25/90 (28%)
Ig_3 265..329 CDD:290638 18/64 (28%)
I-set 346..420 CDD:254352 27/75 (36%)
Ig 360..425 CDD:299845 22/66 (33%)
Ig5_KIRREL3-like 428..524 CDD:143235 34/101 (34%)
IG_like 435..524 CDD:214653 30/94 (32%)
Kirrel3XP_017451106.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C91613883
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D141865at33208
OrthoFinder 1 1.000 FOG0000741
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11640
Phylome 1 0.910 0.857 Consistency score
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.