DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rst and SDK1

Sequence 1:NP_001284835.1 Gene:rst FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_689957.3 Gene:SDK1 HGNCID:19307 Length:2213 Species:Homo sapiens

Alignment Length:570 Identity:112/571 (20%)
Similarity:183/571 (32%) Gaps:202/571 (35%)


  Fly     6 QLLLLATIV---------------GMVRSSPYTSYQNQR-----------FAMEPQDQTAVVG-A 43
            ||::|||..               |..::||:......|           ..:.|.:::.|.| :
Human   245 QLVILATTTSDAGAYYVQAVNEKNGENKTSPFIHLSIARDVGTPETMAPTIVVPPGNRSVVAGSS 309

  Fly    44 RVTLPC----RVINKQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDYSLDIYPVMLDDDAR 104
            ..||.|    |.: :..::.|.::  |:..:..|..|.|...:.:....            |...
Human   310 ETTLECIASARPV-EDLSVTWKRN--GVRITSGLHSFGRRLTISNPTSA------------DTGP 359

  Fly   105 YQCQVS-PGPEGQPAIRSTFAGLTVLVPP---EAPKITQGDVIYATEDRKVEIECVSVGGKPAAE 165
            |.|:.: ||...:||..:.|  |.::.||   ..|:    ..|.|..:..|:|.|.::|      
Human   360 YVCEAALPGSAFEPARATAF--LFIIEPPYFTAEPE----SRISAEVEETVDIGCQAMG------ 412

  Fly   166 ITWIDGLGNVLTDNIEYTVIPLPDQRRF-TAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKI 229
                               :|||..:.: .|.|:.||               ||           
Human   413 -------------------VPLPTLQWYKDAISISRL---------------QN----------- 432

  Fly   230 RVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRW 294
                   |:.||...|.|                              |::   ...|.|     
Human   433 -------PRYKVLASGGL------------------------------RIQ---KLRPED----- 452

  Fly   295 FINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDI-SYAPSFRQRPQSMEAD 358
                                     ..|.:|...|..|:.:....||: :.||.|.|||......
Human   453 -------------------------SGIFQCFASNEGGEIQTHTYLDVTNIAPVFTQRPVDTTVT 492

  Fly   359 VGSVVSLTCEVDSNPQPEIVW-----------IQHPSDRVVGTSTNLTFSVSNETAGRYYC-KAN 411
            .|....|.|||...|:|.|.|           ::.|...::.:.......|..:.||.|.| .||
Human   493 DGMTAILRCEVSGAPKPAITWKRENHILASGSVRIPRFMLLESGGLQIAPVFIQDAGNYTCYAAN 557

  Fly   412 VPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSVPRA--RHVSWTFNGQEISSES 474
            ..|....||...|:.:.| .:........:.|.||.:.|.|:..||.  |:| |..:...::..|
Human   558 TEGSLNASATLTVWNRTS-IVHPPEDHVVIKGTTATLHCGATHDPRVSLRYV-WKKDNVALTPSS 620

  Fly   475 GHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQ 524
            .....:..|       .:|:|..:.:...|.|:|.:|::.|||....:|:
Human   621 TSRIVVEKD-------GSLLISQTWSGDIGDYSCEIVSEGGNDSRMARLE 663

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 21/102 (21%)
Ig 42..114 CDD:299845 15/78 (19%)
C2-set_2 135..225 CDD:285423 16/91 (18%)
Ig_3 265..329 CDD:290638 5/64 (8%)
I-set 346..420 CDD:254352 24/86 (28%)
Ig 360..425 CDD:299845 21/77 (27%)
Ig5_KIRREL3-like 428..524 CDD:143235 23/98 (23%)
IG_like 435..524 CDD:214653 22/91 (24%)
SDK1NP_689957.3 I-set 104..188 CDD:254352
Ig 122..176 CDD:143165
Ig 219..265 CDD:299845 5/20 (25%)
IGc2 312..364 CDD:197706 12/67 (18%)
I-set 386..475 CDD:254352 31/214 (14%)
Ig 404..472 CDD:143165 25/189 (13%)
I-set 480..570 CDD:254352 25/90 (28%)
Ig 494..570 CDD:299845 20/76 (26%)
I-set 575..664 CDD:254352 23/99 (23%)
Ig 580..664 CDD:299845 22/93 (24%)
FN3 668..759 CDD:238020
fn3 771..857 CDD:278470
FN3 872..967 CDD:238020
FN3 972..1054 CDD:238020
FN3 1070..1166 CDD:238020
FN3 1176..1271 CDD:238020
fn3 1279..1365 CDD:278470
FN3 1378..1471 CDD:238020
FN3 1477..1572 CDD:238020
FN3 1580..1694 CDD:238020
FN3 1704..1797 CDD:238020
FN3 1802..1883 CDD:238020
FN3 1903..1996 CDD:238020
PDZ-binding. {ECO:0000250|UniProtKB:Q6V4S5} 2207..2213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.