DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rst and syg-1

Sequence 1:NP_001284835.1 Gene:rst FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001123159.1 Gene:syg-1 WormBaseID:WBGene00006365 Length:730 Species:Caenorhabditis elegans

Alignment Length:811 Identity:201/812 (25%)
Similarity:313/812 (39%) Gaps:173/812 (21%)


  Fly     4 TMQLLLLATIVGMVRSSPYTSYQ-NQRFAMEPQDQTAVVGARVTLPCRVINKQGTLQWTKDDFGL 67
            |..||||..:|        |..| .||....|:|..|.||....|.|||.::||.:||.||||||
 Worm     6 TWPLLLLFQLV--------TCQQLQQRIVEAPKDTLAAVGETAILTCRVEHQQGPVQWMKDDFGL 62

  Fly    68 GTSRD--LSGFERYAMVGSDEEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLV 130
            ||.||  |.|.:||.||||...|:|:|:|..|.|.||..:.||:|.....: |:.|:.|.|||||
 Worm    63 GTDRDKPLPGNKRYRMVGSAANGEYNLEISNVTLFDDDDFACQISESDHAK-AVVSSKAKLTVLV 126

  Fly   131 PPEAPKITQ---------GDVIYATEDRKVEIECVSVGGKPAAEITW-----------IDGLG-- 173
            .|..|||.:         ||.|..:        |:|..|||...|.|           :..||  
 Worm   127 RPTPPKIVKSHHSLKAIAGDPITQS--------CLSRKGKPPPTIGWAIASDEHGKHIVSWLGES 183

  Fly   174 ----------------NVLTDNIEYTVI------PLPDQRRFTAKSVLRLTPKKEHHNTNFSCQA 216
                            .|:....|.|.:      ...|...::..|.|...|:.|..:....|.:
 Worm   184 RSKFGGIHAKPEISQETVIAHVNETTQVEEGGNNSREDSSIYSIMSNLSFIPRPEDDHKYLICIS 248

  Fly   217 QN-TADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLE 280
            |: |.........:::.::|||::.:.|...||                      :.|:....|.
 Worm   249 QHMTFPNKIEVDSVKLSLRYAPQINLTVASKLP----------------------LRENGSALLA 291

  Fly   281 CRADANPSD-VRYRWFINDEPIIGGQKTE-----MVIRNVTRKFHDAIVKCEVQNSVGKSEDSET 339
            |..:|.|.| |:..|:      .|.||..     :....:..:.|:..:.||..|.:|.:..|..
 Worm   292 CNVNAKPLDNVKISWY------KGNQKLRETGDTLTFETLKMEDHNRDIFCEATNEIGTTRGSIK 350

  Fly   340 LDISYAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTF-SVSNETA 403
            |::::........|..|.:.|......|...:||.|.|.|.:..||.::|...|||. :|.....
 Worm   351 LNVAFGARIMSTSQDKEVNEGDNAFFHCATLANPAPAIFWTRGDSDEIIGHGENLTLENVRTWQQ 415

  Fly   404 GRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSVPRARHVSWTFNGQ 468
            |.|.|.|.|.|:.:.....|::::|.|.:..:......:.:...|.|..|..|:..:|.||.||:
 Worm   416 GNYNCTATVEGFRKQILSHYLHIRGPPTVSMKDEVSASLDEATEIICEISGRPKTNNVRWTVNGK 480

  Fly   469 EISSESG----HDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSV 529
            ||:..:|    |.|     ..|.|.:|.|.|:|.:...:|.|||:..|..|.|.....|:.:..:
 Worm   481 EINFNNGRITVHQY-----PKPYGKESILKIKDLKEEDFGVYNCSANNGLGFDNRGTLLKKRNIL 540

  Fly   530 SLLMTIVGGISVVAFLLVLTILVVVYIKCKKRTKLPPADVISEHQITKNGGVSCKLEPGDRTSNY 594
            ..::.......:||..::...:::|.:.|..                    ..|:.....|.|.:
 Worm   541 DWIVITAKFDRMVALAIISAGVLLVSLLCCL--------------------CMCRSNCRSRKSKF 585

  Fly   595 SDLKVDIS-------GGYVPYGDYSTHYSPPPQYLTTCSTKSNGSSTIMQNNHQNQL-------- 644
            .|.:.|::       |.|.|     ..||..|......|||...|  |.|||.....        
 Worm   586 IDDQSDVTVKCEALDGQYFP-----EMYSSSPVDNVHLSTKDYIS--IPQNNPDLDFLGATGSFG 643

  Fly   645 -----------QLQQQQQQSHHQHHTQTTTLPMTFLTNSSGGSLTGSIIGSREIRQDNGLPSLQS 698
                       ....:...:.::|         ::.:..||.|..|.:.....:...:.||.:::
 Worm   644 PPGGLYPKCFNNSANEYIYNRYEH---------SYGSFGSGLSTPGGVSDMYGVAMSDKLPVMET 699

  Fly   699 --TTASVVSSSPNGSCSNQSTTAATTTTTHV 727
              ...:..:|:.|...|.:.....:.|:|||
 Worm   700 LQEVETPKTSNYNFLSSPEVVRPISRTSTHV 730

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653 49/98 (50%)
Ig 42..114 CDD:299845 38/74 (51%)
C2-set_2 135..225 CDD:285423 26/135 (19%)
Ig_3 265..329 CDD:290638 14/70 (20%)
I-set 346..420 CDD:254352 22/75 (29%)
Ig 360..425 CDD:299845 21/66 (32%)
Ig5_KIRREL3-like 428..524 CDD:143235 30/100 (30%)
IG_like 435..524 CDD:214653 28/93 (30%)
syg-1NP_001123159.1 I-set 24..124 CDD:254352 48/101 (48%)
Ig 30..124 CDD:299845 46/95 (48%)
Ig <151..265 CDD:299845 20/122 (16%)
Ig_2 276..353 CDD:290606 21/105 (20%)
IG_like 283..353 CDD:214653 18/76 (24%)
IG_like 363..427 CDD:214653 22/64 (34%)
Ig_2 368..438 CDD:290606 21/70 (30%)
Ig 440..528 CDD:299845 28/93 (30%)
IG_like 450..535 CDD:214653 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131146810
eggNOG 1 0.900 E1_KOG3510
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 203 1.000 Inparanoid score I2416
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D141865at33208
OrthoFinder 1 1.000 FOG0000741
OrthoInspector 1 1.000 T374788
orthoMCL 1 0.900 OOG5_130832
Panther 1 1.100 O PTHR11640
Phylome 1 0.910 0.833 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.