DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: rst and Papln

Sequence 1:NP_001284835.1 Gene:rst FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster
Sequence 2:NP_001192272.1 Gene:Papln MGIID:2386139 Length:1302 Species:Mus musculus

Alignment Length:394 Identity:83/395 (21%)
Similarity:122/395 (31%) Gaps:137/395 (35%)


  Fly   257 GAGGGSVHMSTGSRIVEHSQVRLECRADAN----PSDVRYRWFINDEPI-------------IGG 304
            ||.|...|:..|.|.....|.....||.|.    ||.....|....||.             .||
Mouse   834 GAAGHRAHVDGGQRGPGGQQEPDWHRAGATIPRLPSPSGSPWRREQEPAPGEPPHIPAYGNRPGG 898

  Fly   305 QKTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFRQR-----PQSMEADVGSVVS 364
            |:....:..:.|:...|:..                  :::||:|.|     |..::|..|..|.
Mouse   899 QEIRPRVPGLDREARPAVPP------------------THSPSYRIRLAGSEPSLVQAAPGQAVQ 945

  Fly   365 LTC------EVDSNPQPEIVWIQHPSDRVVGTSTNLTFSVSNETAGRYYCKANVPGY--AEI--- 418
            |.|      |..:..|.|...|.....::....:.:...:..|.||.|.|.::.||:  .||   
Mouse   946 LFCPGNIPSEFQAGWQKEGRPISSNRYQLQADGSLIISRLRPEDAGIYSCGSHRPGHEPQEIQLR 1010

  Fly   419 --SADAYVYLKGSP------------------AIGSQ---------------------RTQYGLV 442
              ..|..|:.:|.|                  ..|::                     |||.|:|
Mouse  1011 VTGGDMAVFPEGQPRHFPEPRNPDLGHGPPHRGTGAEAGGHRVLSPSHPRPATRLRLDRTQPGVV 1075

  Fly   443 ----GDTARIECFASSVPRARHVSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHY 503
                |...|:.|.|...| ...:.|..:||.:||.. |...      |.|   :|:|........
Mouse  1076 DASPGQRIRLTCRAEGFP-VPTIEWQRDGQLVSSPR-HQVQ------PDG---SLVISRVDVEDG 1129

  Fly   504 GKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGGISVVAFLLVLTILVVVYIKCKKRTKLPPAD 568
            |.|:|...|....|...:||:..:.    :||.|                          ||||.
Mouse  1130 GYYSCVAFNGQDRDQRWVQLRVLRE----LTITG--------------------------LPPAV 1164

  Fly   569 VISE 572
            .::|
Mouse  1165 TVAE 1168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
rstNP_001284835.1 IG_like 34..130 CDD:214653
Ig 42..114 CDD:299845
C2-set_2 135..225 CDD:285423
Ig_3 265..329 CDD:290638 16/81 (20%)
I-set 346..420 CDD:254352 23/92 (25%)
Ig 360..425 CDD:299845 19/78 (24%)
Ig5_KIRREL3-like 428..524 CDD:143235 30/139 (22%)
IG_like 435..524 CDD:214653 27/114 (24%)
PaplnNP_001192272.1 TSP1 30..81 CDD:214559
ADAM_spacer1 184..299 CDD:283607
TSP1 309..362 CDD:214559
TSP1 389..447 CDD:214559
TSP1 447..504 CDD:214559
TSP1 511..562 CDD:214559
Kunitz_BPTI 771..823 CDD:278443
Papilin_u7 831..922 CDD:293232 20/106 (19%)
Ig 932..>995 CDD:299845 14/63 (22%)
IG_like 1072..1151 CDD:214653 24/90 (27%)
IGc2 1079..1138 CDD:197706 18/70 (26%)
I-set 1157..1241 CDD:254352 7/39 (18%)
IGc2 1168..1226 CDD:197706 1/2 (50%)
PLAC 1257..1289 CDD:285849
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.