DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14421 and CG14850

DIOPT Version :8

Sequence 1:NP_570042.1 Gene:CG14421 / 31285 FlyBaseID:FBgn0029644 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_650371.1 Gene:CG14850 / 41762 FlyBaseID:FBgn0038239 Length:158 Species:Drosophila melanogaster

Alignment Length:210 Identity:64/211 (30%)
Similarity:83/211 (39%) Gaps:67/211 (32%)


  Fly     3 LLKGLLI-VACL-----AAFASAKPQNFQIFGRQRDEPAAQGRLSATQLTDLLNSLKGSSSSTTA 61
            :|.|:|: ||||     |...:|.|                   :.|...|...| .........
  Fly     7 ILSGVLVLVACLLRSSEAVTCTADP-------------------NVTGCIDCTTS-PSDPECVAE 51

  Fly    62 APTTTTLPSTSTVTTSPTGPTTSTGTSTTTTTPTTTSPTGTTT-ARQLEPLDDQEDDDEEEQQLG 125
            |..|||.|:..|.||:||...::..|...:|||  |||:||.| |....|.|.....|....   
  Fly    52 AANTTTKPADGTDTTTPTTGGSTDATPAGSTTP--TSPSGTVTPAPTSSPSDSTSPSDSTPT--- 111

  Fly   126 HHQRFQLEDQNDDEEEHTQVARSQANRRRQVNARRQRQRLQQKYRRRQQQQRRRRQQQQQKRRQQ 190
                             :..|.:.|.|||::.|||             :.|||||.|    ||:.
  Fly   112 -----------------SNNAAAVARRRRRMAARR-------------RAQRRRRAQ----RRRD 142

  Fly   191 QKRRQQQRRRRQQNQ 205
            |:||:.||||| |||
  Fly   143 QRRRRAQRRRR-QNQ 156



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23246
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.