DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14421 and CG4297

DIOPT Version :8

Sequence 1:NP_570042.1 Gene:CG14421 / 31285 FlyBaseID:FBgn0029644 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_608527.2 Gene:CG4297 / 33222 FlyBaseID:FBgn0031258 Length:1472 Species:Drosophila melanogaster

Alignment Length:83 Identity:21/84 (25%)
Similarity:41/84 (49%) Gaps:6/84 (7%)


  Fly    51 SLKGSSSSTTAAPTTTTLPSTS----TVTTSPT--GPTTSTGTSTTTTTPTTTSPTGTTTARQLE 109
            |:.|.||.:::.|.:::..|:|    :.||:||  |...::.||....|..|.:|..:.....|:
  Fly    21 SVSGLSSGSSSGPGSSSSGSSSSGYGSATTTPTSGGHYDNSPTSMPMATIATVAPFYSEALTSLD 85

  Fly   110 PLDDQEDDDEEEQQLGHH 127
            ....|:...:::|...|:
  Fly    86 AQQRQQQQQQQQQNPSHY 103



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23246
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.