DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3526 and RNF125

DIOPT Version :10

Sequence 1:NP_726832.2 Gene:CG3526 / 31277 FlyBaseID:FBgn0040355 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_060301.2 Gene:RNF125 / 54941 HGNCID:21150 Length:232 Species:Homo sapiens


Alignment Length:191 Identity:42/191 - (21%)
Similarity:62/191 - (32%) Gaps:55/191 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PRRRQIGHTSGHCNVRCDGCGNNRMTFYRYKCLHC-------------------LDYDLCSDCKE 61
            |.|.:.||      |.|..|....:...::.|.:|                   .:|..|::|  
Human    47 PVRTRCGH------VFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAEC-- 103

  Fly    62 NGVSNGLHSLDHPLQCLMDRDALELHFAG--------EPIPIL--CADSFTCPVCGEMGFSVEDL 116
                       ..|.||.:   :..|...        .|:..|  .|....||.| :.....:.|
Human   104 -----------DTLVCLSE---MRAHIRTCQKYIDKYGPLQELEETAARCVCPFC-QRELYEDSL 153

  Fly   117 RTHCQDNHRMARTVCICPVCAAVPLSQPSHIA-HIANHLMFSPSHRATGDPMIDISATSQA 176
            ..||..:||..|....||:|..:|...||..: .:..||..  ||....|..||.:...:|
Human   154 LDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQV--SHTLFYDDFIDFNIIEEA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3526NP_726832.2 ZZ_PCMF_like 30..78 CDD:239078 9/66 (14%)
zf-Di19 99..149 CDD:428539 15/50 (30%)
RNF125NP_060301.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
RING-HC_RNF125 34..83 CDD:438204 9/41 (22%)
Interaction with the C2HC RNF-type zinc finger. /evidence=ECO:0000269|PubMed:27411375 43..45
zf_C2HC_14 94..126 CDD:465807 7/47 (15%)
Interaction with the RING-type zinc finger. /evidence=ECO:0000269|PubMed:27411375 109..113 1/6 (17%)
Linker region. /evidence=ECO:0000269|PubMed:27411375 120..128 0/7 (0%)
zf-Di19 141..>173 CDD:428539 11/32 (34%)
Required for interaction with ubiquitin and for autoubiquitination. /evidence=ECO:0000269|PubMed:17990982 210..224 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.