DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32795 and tmem120b

DIOPT Version :8

Sequence 1:NP_001245509.1 Gene:CG32795 / 31270 FlyBaseID:FBgn0040384 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001011029.1 Gene:tmem120b / 496438 XenbaseID:XB-GENE-6087368 Length:335 Species:Xenopus tropicalis

Alignment Length:329 Identity:158/330 (48%)
Similarity:222/330 (67%) Gaps:1/330 (0%)


  Fly     1 MNIDSLKNEWEELNKEFAELESCNRRYIELLEQLHSHQQICFNEIKHQRYRMNQITTSLRQFKGP 65
            |::...:.||.||.|||.:|:..::.|.:.||:|:..|.:|.:.|...:.|:.::..:|..:|..
 Frog     1 MSLQKCQEEWGELEKEFQQLQETHKVYKQKLEELNGLQNLCSSYINKHKRRLTELKGNLHGYKHT 65

  Fly    66 VPAEDKEKVDDLHKMTLKRKAQLHEIEQSLPAKSGRYLQIILGDVNVSILNRNDKVRYKDDYEKF 130
            ...|:||.|..::....:|.....::|..||.|:|.||.::||:|||::|:...|..|||:||||
 Frog    66 SNVEEKELVQQINSTIKERHNAFFDMEAYLPKKNGLYLNLVLGNVNVTLLSNQAKFAYKDEYEKF 130

  Fly   131 KLILNVIGLIMAF-FNLIFNYRALELAFIFLLVWYYCTLTIRESILKVNGSRIKGWWRAHHFIST 194
            ||.|.:|.|:.|. ...:.:||..:..|.|||||||||||||||||..|||||||||.:||::||
 Frog   131 KLYLTIILLLGAITCRFVLHYRVTDEVFNFLLVWYYCTLTIRESILISNGSRIKGWWVSHHYVST 195

  Fly   195 VAAGVLLVWPQGEHWQIFRMQFMYFNVYISIVQYLQFGYQKGLLYRLKALGERHNMDITIEGFHS 259
            ..:||:|.||.|..:||||.||:.|::|.|.||:||:.||.|.||||:|||||:::|:|:|||.|
 Frog   196 FLSGVMLTWPDGLMYQIFRNQFLAFSIYQSCVQFLQYYYQSGCLYRLRALGERNHLDLTVEGFQS 260

  Fly   260 WMWRGLSFLLPFLFIGYGYQAYNAWTLYKLAYSPPDAPWHVSVMSGLFLLLFVGNMATTLWVVPE 324
            ||||||:|||||||.|:.:|.|||.||:.|:.......|.|.|::..|||||:||..|||.||..
 Frog   261 WMWRGLTFLLPFLFFGHFWQLYNAITLFGLSRHEECKEWQVFVLALTFLLLFLGNFLTTLKVVHT 325

  Fly   325 KIRE 328
            |.::
 Frog   326 KFQK 329

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32795NP_001245509.1 TMPIT 7..329 CDD:285135 157/324 (48%)
tmem120bNP_001011029.1 TMPIT 7..330 CDD:311687 157/324 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17325150
eggNOG 1 0.900 E1_KOG4758
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 322 1.000 Inparanoid score I2340
OMA 1 1.010
OrthoDB 1 1.010 D398151at33208
OrthoFinder 1 1.000 FOG0002215
OrthoInspector 1 1.000 T601383
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3603
TreeFam 1 0.960
1110.800

Return to query results.
Submit another query.