DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2701 and ASCC2

Sequence 1:NP_570025.1 Gene:CG2701 FlyBaseID:FBgn0024973 Length:735 Species:Drosophila melanogaster
Sequence 2:XP_024308055.1 Gene:ASCC2 HGNCID:24103 Length:816 Species:Homo sapiens

Alignment Length:800 Identity:225/800 (28%)
Similarity:373/800 (47%) Gaps:125/800 (16%)


  Fly    17 LPLDELKFALSGKD---GVRRNVPAL------DEHWV-QREKPFASYLCMLSSYGRLKSGAALEE 71
            ||||:|:  ::.||   |..|..|||      |.::| .:..|..:...::..|        ||.
Human    58 LPLDQLQ--ITHKDPKTGKLRTSPALHPEQKADRYFVLYKPPPKDNIPALVEEY--------LER 112

  Fly    72 WTFAANNFRGDMEFLLSLTQHEFWSYMVYDESAMAAVVTFLQRANPYYRQTDVSRDKELDQAHLL 136
            .||.||    |:::||:|...:||..:::||:....:.::|:..           .::.|:....
Human   113 ATFVAN----DLDWLLALPHDKFWCQVIFDETLQKCLDSYLRYV-----------PRKFDEGVAS 162

  Fly   137 YGQLLDLVVRL-------IMRLCTGKESDSEWISPKQHGSLLYSNYLISVPLLFDLLIAVGDAEP 194
            ..:::|:..||       .:|:.|.|||...:|||...|.:||:|:|..:|.:.||.:..|..  
Human   163 APEVVDMQKRLHRSVFLTFLRMSTHKESKDHFISPSAFGEILYNNFLFDIPKILDLCVLFGKG-- 225

  Fly   195 ENVELLRQIFDKVLEVQPEYQKDLKEALIFYESAFLSMQIQVENEGCEGAGGGASLDVDLE---- 255
             |..||:::...:...||.|..||.|.|......|.::   :::.|.:|.|...: ...||    
Human   226 -NSPLLQKMIGNIFTQQPSYYSDLDETLPTILQVFSNI---LQHCGLQGDGANTT-PQKLEERGR 285

  Fly   256 -TPYD-------DVVLFAMDCAYTLRLLLLLCPQLLETIEQLRLAPSIANFYDMTVPMLYKNIYL 312
             ||.|       |:||:..|...||...|.:.|...:|.::......:|:||:..:|.:...|..
Human   286 LTPSDMPLLELKDIVLYLCDTCTTLWAFLDIFPLACQTFQKHDFCYRLASFYEAAIPEMESAIKK 350

  Fly   313 VNPGASSL---RW--LNETRQQ----YIFIVRRVVSLQ-MES------GRGQQLVEVMQECLSAQ 361
            .....|.|   .|  |:.:|::    :..|:.::..|. :||      |..::.:::....|..:
Human   351 RRLEDSKLLGDLWQRLSHSRKKLMEIFHIILNQICLLPILESSCDNIQGFIEEFLQIFSSLLQEK 415

  Fly   362 NFVVDYQRQFPLEHDMKLLIQRCPNIKNYEVDFVVSGYQKAL----------ASCPNGIMADDMA 416
            .|:.||...||:..|:.||.|....:......:::...:.|.          |..|:.|...:..
Human   416 RFLRDYDALFPVAEDISLLQQASSVLDETRTAYILQAVESAWEGVDRRKATDAKDPSVIEEPNGE 480

  Fly   417 SNGVQVTGNVQDEEFKNGDSSR------TSPQPSPTANGTTRDIDLEVTAVLEVLPDLGSGFIRR 475
            .|||.||.....:...:.::|.      .:....|...|.  ::|..::.|.::|||||.|||..
Human   481 PNGVTVTAEAVSQASSHPENSEEEECMGAAAAVGPAMCGV--ELDSLISQVKDLLPDLGEGFILA 543

  Fly   476 LLIRYD-NSEQVIAAILDDNLPPDLAQMDRQ-EVYIPPDPQDKQQRQTGL---RHFNVHDGDRYD 535
            .|..|. :.||||..||::.|.|.|:|:||. :..:.|||       |.|   || ||...|.:|
Human   544 CLEYYHYDPEQVINNILEERLAPTLSQLDRNLDREMKPDP-------TPLLTSRH-NVFQNDEFD 600

  Fly   536 VLTRDQPECI-IKQGKGLPGAPRNAEQLLDDKRDLKQLKERYQKYA-MVEETTLERGE------- 591
            |.:||..:.. :.:||. .....|...||:|||.:...::||::|: :|||..|:.||       
Human   601 VFSRDSVDLSRVHKGKS-TRKEENTRSLLNDKRAVAAQRQRYEQYSVVVEEVPLQPGESLPYHSV 664

  Fly   592 -YDDEYDDSYEAQNEGQAPPVS---LLRGR---LQEAASSSAYNAQDELENDDEESSGGHSDPEP 649
             |:|||||:|:....|.....|   |:..|   :.:...:.......|.::||||.......|:.
Human   665 YYEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEEDDDDEEDDADEEAPKV 729

  Fly   650 SMRTNRDFCENPEVIRARYEQRQLSKYGQKSGGHGASPSVVGAPKGQGQSQQTQRSRGQKEAHKS 714
            .......|.::|.|:|.:.|.|:::...:|...|.:|.:|.|:|:|.|||::|.:.|.:|||:|:
Human   730 PPWQPDHFVQDPAVLREKAEARRMAFLAKKGYRHDSSTAVAGSPRGHGQSRETTQERRKKEANKA 794

  Fly   715 TRANHNRKAGAAFKRSKGMM 734
            |||||||:..|..||||||:
Human   795 TRANHNRRTMADRKRSKGMI 814

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2701NP_570025.1 CUE_ASCC2 455..493 CDD:270547 18/39 (46%)
ASCC2XP_024308055.1 CUE_ASCC2 523..562 CDD:270547 18/39 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C359508939
eggNOG 1 0.900 E1_KOG4501
Hieranoid 1 1.000
Homologene 1 1.000 H41774
Inparanoid 1 1.050 250 1.000 Inparanoid score I3188
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D311659at2759
OrthoFinder 1 1.000 FOG0007619
OrthoInspector 1 1.000 T1072510
orthoMCL 1 0.900 OOG5_132432
Panther 1 1.100 LDO PTHR21494
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5011
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.