DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2701 and Ascc2

Sequence 1:NP_570025.1 Gene:CG2701 FlyBaseID:FBgn0024973 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_083567.1 Gene:Ascc2 MGIID:1922702 Length:749 Species:Mus musculus

Alignment Length:791 Identity:217/792 (27%)
Similarity:366/792 (46%) Gaps:120/792 (15%)


  Fly    17 LPLDELKFALSGKD---GVRRNVPALDEHWVQREKPFASYLCMLSSYGRLKSGAALEEWTFAANN 78
            ||||:|:  ::.||   |..:...||:.     |:....|..:.....:....|.:||:...||.
Mouse     4 LPLDQLQ--ITHKDPKTGQPKTSAALNP-----EQKADRYFVLYKPPPKDNIPALVEEYLERANF 61

  Fly    79 FRGDMEFLLSLTQHEFWSYMVYDESAMAAVVTFLQRANPYYRQTDVSRDKELDQAHLLYGQLLDL 143
            ...|:::||:|...:||..:::||:....:.::|......:.:......:..|..:.|:..    
Mouse    62 VANDLDWLLALPHDKFWCQVIFDETLQKCLDSYLHYVPRKFDEWVAPTPEVADMQNHLHRS---- 122

  Fly   144 VVRLIMRLCTGKESDSEWISPKQHGSLLYSNYLISVPLLFDLLIAVGDAEPENVELLRQIFDKVL 208
            |....:|:.|.|||...:|||...|.:||:|:|..:|.:.||.:..|..   |..||:::...:.
Mouse   123 VFLTFLRMSTHKESKDHFISPSAFGEILYNNFLFDIPKILDLCVLFGKG---NSPLLQKMIGNIF 184

  Fly   209 EVQPEYQKDLKEALIFYESAFLSMQIQVENEGCEGAGGGASLDVDLE----TPYD-------DVV 262
            ..||.|..||.|.:......|.::   :::.|.:|.|...:.....|    ||.|       |:|
Mouse   185 TQQPSYYTDLDETIPTILQVFSNI---LQHCGLQGDGTSTTPQKLGERSPLTPSDMPLLELKDIV 246

  Fly   263 LFAMDCAYTLRLLLLLCPQLLETIEQLRLAPSIANFYDMTVPMLYKNIYLVNPGASSL---RW-- 322
            |:..|.:.||...|.:.|...:|.::......:|:||:|.:|.|...|.......|.|   .|  
Mouse   247 LYLCDTSTTLWAFLDIFPLACQTFQKHDFCYRLASFYEMAIPELESAIKKRRLEDSKLLGDMWQR 311

  Fly   323 LNETRQQ----YIFIVRRVVSLQ-MES------GRGQQLVEVMQECLSAQNFVVDYQRQFPLEHD 376
            |:.::::    :..|:.::..|. :||      |..::.:::....|..:.|:.||....|:..|
Mouse   312 LSHSKKKLMEVFHIILNQICLLPILESSCDNIQGFIEEFLQIFSSLLQEKRFLRDYDTFSPVAED 376

  Fly   377 MKLLIQRCPNIKNYEVDFVVSGYQKALASCPNGIMAD-------DMASNGVQVTG---------- 424
            :.||.|....:......:::...:.|........:.|       ..::|.|.||.          
Mouse   377 ISLLQQASSALDETRTAYILQAVESAWEGVDRQKIKDIKDPPRAKGSNNEVTVTAEPVSEMPSQL 441

  Fly   425 -NVQDEEFKNGDSSRTSPQPSPTANGTTRDIDLEVTAVLEVLPDLGSGFIRRLLIRYD-NSEQVI 487
             |::::|...|.::...|..|..      ::|..::.|.::|||||.|||...|..|. :|||||
Mouse   442 ENLEEDEECMGAAAALGPAVSGV------ELDSLISQVKDLLPDLGEGFILACLEHYSYDSEQVI 500

  Fly   488 AAILDDNLPPDLAQMDR-QEVYIPPDPQDKQQRQTGL---RHFNVHDGDRYDVLTRDQPECIIKQ 548
            ..||:|.|.|:|:|:|| .|..:.|||       |.|   || |:...|.:||.:||..: :.:.
Mouse   501 NNILEDRLAPELSQLDRGLERQVKPDP-------TPLLSSRH-NIFQNDEFDVFSRDSVD-LSRV 556

  Fly   549 GKGLPGAPRNAEQLLDDKRDLKQLKERYQKYA-MVEETTLERGE-----YDDEYDDSYEAQNEGQ 607
            .|| .....|...|::||:.:....:|||||: :|||..|:.||     |:|||||:|:....|.
Mouse   557 HKG-RRKEENVRSLVNDKQAVVAQWQRYQKYSVVVEEVPLQPGEYQADDYEDEYDDTYDGNQVGA 620

  Fly   608 APPVS--------------LLRGRLQEAASSSAYNAQDELENDDEESSGGHSDPEPSMRTNRDFC 658
            ....|              :||.::........::.:||:|   ||:      |:|.     .|.
Mouse   621 NDADSDDELISRRPFTIPQVLRTKMPGEVQEEEWDEEDEVE---EEA------PKPD-----HFI 671

  Fly   659 ENPEVIRARYEQRQLSKYGQKSGGHGASPSVVGAPKGQGQSQQTQRSRGQKEAHKSTRANHNRKA 723
            ::|.|:|.:.|.|:::...:|......|.:|.|.|:|.|||::|.:.|.:|||:|:.||||||:.
Mouse   672 QDPAVLREKAEARRMAFLARKGYRPENSTAVTGGPRGHGQSRETTQERRKKEANKAARANHNRRT 736

  Fly   724 GAAFKRSKGMM 734
            .|..||||||:
Mouse   737 MADRKRSKGMI 747

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2701NP_570025.1 CUE_ASCC2 455..493 CDD:270547 19/39 (49%)
Ascc2NP_083567.1 CUE_ASCC2 467..506 CDD:270547 19/39 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C359508140
eggNOG 1 0.900 E1_KOG4501
Hieranoid 1 1.000
Homologene 1 1.000 H41774
Inparanoid 1 1.050 231 1.000 Inparanoid score I3412
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007619
OrthoInspector 1 1.000 T1082576
orthoMCL 1 0.900 OOG5_132432
Panther 1 1.100 LDO PTHR21494
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5011
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.