DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2701 and AT1G27752

Sequence 1:NP_570025.1 Gene:CG2701 FlyBaseID:FBgn0024973 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_001077611.1 Gene:AT1G27752 AraportID:AT1G27752 Length:873 Species:Arabidopsis thaliana

Alignment Length:783 Identity:173/784 (22%)
Similarity:299/784 (38%) Gaps:196/784 (25%)


  Fly    86 LLSLTQHEFWSYMVYDESAMAAVVTFLQRAN-----PYYRQTDVSRDKELDQAHLLYGQLLDLVV 145
            ||.|...:||..:..|.|....:.:|||..:     |::....:       .|.::.|: |:|..
plant   130 LLKLNPRDFWREVASDASLHDFLDSFLQFRSRWYDFPFHGVKGI-------VAGVIVGE-LELCR 186

  Fly   146 RLIMRLCT--------GKESDSEWISPKQHGSLLYSNYLISVPLLFDLLIAVGDAEPENVELLRQ 202
            |:.|.|..        .|.:||  :|.|.|..||....|:.:|.|.|:....|.   ||.||.:.
plant   187 RVFMVLYRISSNRDPGAKAADS--LSQKDHEVLLQDKKLLDLPKLLDICAIYGH---ENAELTKS 246

  Fly   203 IFDKVLEVQPEYQKDLKEALIFYESAFL------------SMQIQVENEGCEGAGGGASLDVDL- 254
            :.:..:    :.|..:.|:|....|.||            |::..|.:...|. .|...|..|| 
plant   247 LIENAV----KSQNGISESLNMMLSHFLGILHTMHHRCTSSLETLVSSANSED-HGRRQLHSDLL 306

  Fly   255 ---ETPYDDVV-LFAMDCAYTLRLLLLLCPQLLETI----EQLRLAPSIANFYDMTVPMLYKNIY 311
               :...|.|| |.|...|||..:.:|.||  :||.    |.||   |:...:|..:|.|::...
plant   307 EVMDFINDGVVSLDAFISAYTPAVFILACP--VETSYGSDELLR---SLVRLHDSLLPSLHRGFQ 366

  Fly   312 LV--NPGASSLRWLNETRQQYIFIVRRVVSLQMESGR-GQQLVEVMQEC-LSAQNF-----VVDY 367
            ::  :....||..::             .||.|.|.| |....:::..| ||...|     :...
plant   367 VLFKDEDHDSLSDIS-------------TSLNMLSTRIGSLCWKILDICYLSNDKFNHETSIPAV 418

  Fly   368 QRQFP--LEHDM---KLLIQRCPNI----------KNYEVDFVVSGYQKALASCPNGIMADDMAS 417
            .:.||  :|..|   .:|||....|          ||..:..:...|:          :.|.:.|
plant   419 TKMFPSRVEDPMVRADILIQTFREISGLSEQSLESKNRLLQKIEKNYR----------IIDRLRS 473

  Fly   418 NGVQVTG--NVQDEEFK--------NGDSSRTSPQPSPTANGTTRD---------IDLEVTAVLE 463
              :|..|  :::||:.:        :.|:......|....:|...:         :..:::.:.:
plant   474 --LQNAGWISMEDEQLQYLSMIMLHSADTFSMKESPLLLTDGRNAEELMDENAVVMQSKISQIKD 536

  Fly   464 VLPDLGSGFIRRLLIRYD-NSEQVIAAILDDNLPPDLAQMDRQEVYIPPDPQDKQQRQTGLRHFN 527
            :.|:.|:||:...|..|: |.|:||..||:..|..||.::|..   :...||.|.  ...||..:
plant   537 IFPEYGNGFLAACLEAYNQNPEEVIQRILEGTLHEDLQRLDTS---LETMPQPKS--APTLRSKD 596

  Fly   528 VHDGDRYDVLTRDQPECIIKQGKGL--PGAPRNAEQLLDDKRDLKQLKERYQKYAMVE---ETTL 587
            ...|...:..|......|..: |.:  |..|.::.......|.:::.|:....|.:::   |:..
plant   597 KGKGKLIESDTSSSASAIYTE-KPITRPSLPASSASSATVGRFVRKPKDDTPSYKILDARKESDR 660

  Fly   588 ERG-------EYDDEYDDSYEAQNEGQAPPVSLLRGRLQEAASSSAYNAQDELENDDEESSGGHS 645
            ||.       |||||||||::...      :|:.....:|   |.|:..:...|..|....|...
plant   661 ERNAALLAQYEYDDEYDDSFDDLG------LSIAESGTEE---SGAFGNRAGSEPSDAPKWGSRK 716

  Fly   646 DPEPSMRTNRDFC-------------ENPEVIRARYEQ---------------RQLSKYGQKSGG 682
            :|:..::..:::.             |...|..|..::               |:|::|..:...
plant   717 NPQFYVKDGKNYSYKVAGAVAVANANEASLVNEAEGDKILGLGRGGNIPLGAVRKLTEYQAQRDE 781

  Fly   683 HGASPSVVGAPKGQ--GQSQQTQRSRG---------QKEAHKSTRANH--NRKA--GAAFKRSKG 732
            .|.|...|....|:  |::.:..|.||         |:::::|:..|.  |.:|  |....|.:|
plant   782 KGQSNVNVNPSDGRENGRNWRGVRGRGRGVVNREQPQEKSNESSNNNSEVNTEAENGGGRGRGRG 846

  Fly   733 MMG 735
            ..|
plant   847 RRG 849

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2701NP_570025.1 CUE_ASCC2 455..493 CDD:270547 12/39 (31%)
AT1G27752NP_001077611.1 CUE_ASCC2 528..567 CDD:270547 12/39 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D311659at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132432
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
32.820

Return to query results.
Submit another query.