DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2701 and ascc2

Sequence 1:NP_570025.1 Gene:CG2701 FlyBaseID:FBgn0024973 Length:735 Species:Drosophila melanogaster
Sequence 2:NP_956736.1 Gene:ascc2 ZFINID:ZDB-GENE-040426-1223 Length:768 Species:Danio rerio

Alignment Length:824 Identity:224/825 (27%)
Similarity:367/825 (44%) Gaps:169/825 (20%)


  Fly    17 LPLDELKFALS-GKDGVRRNVPALDEHWVQREKPFASYLCMLSSYGRLKSG--AALEEWTFAANN 78
            :|||||..... |..|..|.:|||  |..::|:     .|.|......:.|  |.:||:...|..
Zfish     6 VPLDELHVTEHFGPQGKERTLPAL--HPDRKEE-----RCFLPFKPPPEDGTPALVEEFLEHAQF 63

  Fly    79 FRGDMEFLLSLTQHEFWSYMVYDESAMAAVVTFLQRANPYYRQTDVSRDKELDQAHL-------- 135
            ...|:::||:|...:||..:|:|||....:.::|:.|           .:.||.:.|        
Zfish    64 ISEDLDWLLALPHDKFWCQVVFDESLQGCLDSYLRHA-----------PRGLDPSGLSSSPAVAD 117

  Fly   136 LYGQLLDLVVRLIMRLCTGKESDSEWISPKQHGSLLYSNYLISVPLLFDLLIAVGDAEPENVELL 200
            :...:...:..:.:|:.|.|||...:|:|.....::|:|||..:|.:.||.:..|..   |.:||
Zfish   118 MQRNIHRSMFMVFLRMATHKESKEHFITPAVFAEIIYNNYLFDIPKILDLCVLYGKG---NSQLL 179

  Fly   201 RQIFDKVLEVQPEYQKDLKEALIFYESAF-LSMQ---IQVENEGCEGAGGGASLDVDL------- 254
            .::.|.:...||.|..||.|.:......| :.:|   ||.|:   .|||....|:.:.       
Zfish   180 HKMIDNIFTQQPSYYGDLNETIPSIIQVFDIILQKCGIQSED---TGAGQPLKLNANRCLTAMTM 241

  Fly   255 -ETPYDDVVLFAMDCAYTLRLLLLLCPQLLETIEQLRLAPSIANFYDMTVPMLYKNIYLVNPGAS 318
             |....|:|.:..|...|:...|.:.|:...|.:|......:.:||:|.||.|.|.:...|...|
Zfish   242 PEEELADLVSYMCDTCTTIHSFLDIFPEACSTFKQHNFLNRLPSFYEMAVPDLEKAVKKRNFDKS 306

  Fly   319 ----SLRWLNETRQQYIFIVRRVVS---LQ--MESGRG-----QQLVEVMQECLSAQNFVVDYQR 369
                ..|.::.:|::.:.|...::.   ||  :|....     :.|::.....|..:.|:.||..
Zfish   307 LQEDMWRRVSYSRKKMVEIAHLLLQHACLQPILEGSENVASFVEDLLQNFTTFLQEKRFLADYDE 371

  Fly   370 QFPLEHDMKLLIQRCPNIKNYEVDFVVSGYQKALASC------PNGIMAD------------DMA 416
            ||||..|:.||.|..|::......:::.|.:.|..|.      |:.|.:.            |:|
Zfish   372 QFPLADDISLLQQAFPHLDETRTSYLLQGVESAWESVGKKRSFPSAISSSNHRAGAKSKTGRDLA 436

  Fly   417 SN---GVQVTGNVQDEEFKNGDSSRTSPQPSPTANGTTRDI---DLE--VTAVLEVLPDLGSGFI 473
            ::   |..|:|  ..||.:..::...:|:...  ||....:   :||  ::.:.::|||||.|||
Zfish   437 ASPTEGAGVSG--VREELRGAEAVSYTPRKGD--NGAVCTVSAGELESLLSHIRDLLPDLGEGFI 497

  Fly   474 RRLLIRYD-NSEQVIAAILDDNLPPDLAQMDRQ-----EVYIPPDPQDKQQRQTGLRHFNVHDGD 532
            ...|..|. |||.||..||:|.|.|.|.::||.     :..:||....:.         ||.|.|
Zfish   498 LACLEEYGYNSELVINNILEDKLAPSLDKLDRAMARPVKNELPPVLSTRS---------NVFDDD 553

  Fly   533 RYDVLTRDQPECI-IKQGKGLPGAPRNAEQL---LDDKRDLKQLKERYQKY-AMVEETTLERG-- 590
            .:||..||:.:.. |.:|:      |..|.:   ||||:.:::.:.|||.| .:|:|..:...  
Zfish   554 EFDVFNRDRLDMSRIWKGR------RQGESVRATLDDKQHIEEQRARYQAYQTVVDEIPIANNPS 612

  Fly   591 ----------EYDDEYDDSYEAQNEGQAPPVSLLRGRLQEAASSSAYNAQDELEN---------- 635
                      :|||:|||:|:|...|                 ::..:.:|||.|          
Zfish   613 GDQDNAFGLDDYDDDYDDTYDANQIG-----------------ANDLDEEDELLNRRPFTIPQVL 660

  Fly   636 ----------DDEESSGGHSDPEPSMRTNRDFCENPEVIRARYEQRQLSKYGQKSGGHGASPSVV 690
                      ||||..  ..|...:::.:. |.::|.|:|.|.|.|:.:...:|......:.:||
Zfish   661 RTSKQVQEFDDDEEED--EEDKNEAVKKDH-FIQDPAVLRERAEARRAAMQSRKGYRPPPASNVV 722

  Fly   691 GAPKGQGQSQQTQRSRGQKEAHKSTRANHNRKAGAAFKRSKGMM 734
            |.|||:||:|:|.:.|.:|||.||..|||||::.|..||:|||:
Zfish   723 GGPKGRGQTQETIQDRRRKEASKSRGANHNRRSMADRKRNKGMI 766

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2701NP_570025.1 CUE_ASCC2 455..493 CDD:270547 19/41 (46%)
ascc2NP_956736.1 CUE_ASCC2 479..518 CDD:270547 18/39 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C359509566
eggNOG 1 0.900 E1_KOG4501
Hieranoid 1 1.000
Homologene 1 1.000 H41774
Inparanoid 1 1.050 220 1.000 Inparanoid score I3474
OMA 1 1.010
OrthoDB 1 1.010 D311659at2759
OrthoFinder 1 1.000 FOG0007619
OrthoInspector 1 1.000 T1051933
orthoMCL 1 0.900 OOG5_132432
Panther 1 1.100 LDO PTHR21494
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5011
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.