DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2681 and AT5G53360

Sequence 1:NP_570022.2 Gene:CG2681 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001330825.1 Gene:AT5G53360 AraportID:AT5G53360 Length:233 Species:Arabidopsis thaliana

Alignment Length:128 Identity:27/129 (21%)
Similarity:44/129 (34%) Gaps:27/129 (21%)


  Fly   242 EPFTNSRSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHEQQCMYKPMKC-FMGRVWGDCRWQ 305
            :|......:.:|.:.......|.:.:.||....|......||.||.::|..| :.|   .:|...
plant     7 QPVNQECIIALEKVAESLELPCKYYNLGCLGIFPYYSKLKHESQCNFRPYSCPYAG---SECAAV 68

  Fly   306 GREVQWKEHLEEQH----------DDRLFRSSSADLE---WNLGTRRKPLTGYYVFQAHDEMF 355
            |.......||.:.|          :.|..:|:..::|   |.|          .|||...:.|
plant    69 GDITFLVAHLRDDHKVDMHTGCTFNHRYVKSNPREVENATWML----------TVFQCFGQYF 121

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093 1/2 (50%)
Sina 248..442 CDD:281181 26/123 (21%)
AT5G53360NP_001330825.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D780610at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.643 Consistency score
21.920

Return to query results.
Submit another query.