DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2681 and Siah2

DIOPT Version :9

Sequence 1:NP_570022.2 Gene:CG2681 / 31258 FlyBaseID:FBgn0024997 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_033200.2 Gene:Siah2 / 20439 MGIID:108062 Length:325 Species:Mus musculus


Alignment Length:289 Identity:83/289 - (28%)
Similarity:119/289 - (41%) Gaps:42/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 ATLPSPNVVTLRSPLSPPPKPPMLGRTRSTGPADGKGPASNGALSPDSSIIRQSFPEGVITPSKP 177
            :|.||.|....:.|  |||:.|     .:..||.....|:..|..|.||.:    |......|.|
Mouse     6 STGPSANKPCSKQP--PPPQTP-----HAPSPAAPPAAATISAAGPGSSAV----PAAAAVISGP 59

  Fly   178 EKSPATPSEEGPPTVSARHYEGLIEELRCPGCAGAMKAPILLCKSGHSVCEQCTRILLMCPLCKE 242
                  .:..|...||.:|:| |.....||.|...:..|||.|::||.||.||.:.|..||.|:.
Mouse    60 ------GAGGGADPVSPQHHE-LTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRG 117

  Fly   243 PFTNS-RSLTVEALCAKAHFRCGHASGGCQVRMPVVLLPWHEQQCMYKPMKC-FMGRVWGDCRWQ 305
            ..|.| |:|.:|.:.:...|.|.:|:.||.:.:.....|.||..|.|:|..| ..|   ..|:||
Mouse   118 ALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPG---ASCKWQ 179

  Fly   306 GREVQWKEHLEEQH--------DDRLFRSSSADL----EWNLGTRRKPLTGYYVFQAHDEMFNFY 358
            |.......||...|        :|.:|.::..:|    :|   ...:...|:: |....|....|
Mouse   180 GSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDW---VMMQSCFGHH-FMLVLEKQEKY 240

  Fly   359 EIHDRQRVLFTMTCTSNRRDSKYNFAYEV 387
            |.|.:   .|.:......|....||||.:
Mouse   241 EGHQQ---FFAIVLLIGTRKQAENFAYRL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2681NP_570022.2 RING 206..244 CDD:238093 17/37 (46%)
Sina 248..442 CDD:281181 39/153 (25%)
Siah2NP_033200.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 13/43 (30%)
Sina 123..319 CDD:281181 39/154 (25%)
SBD. /evidence=ECO:0000250|UniProtKB:P61092 131..323 36/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45877
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.