DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2662 and DPF2

DIOPT Version :9

Sequence 1:NP_001284832.1 Gene:CG2662 / 31254 FlyBaseID:FBgn0024993 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_024304405.1 Gene:DPF2 / 5977 HGNCID:9964 Length:575 Species:Homo sapiens

Alignment Length:210 Identity:54/210 - (25%)
Similarity:83/210 - (39%) Gaps:23/210 - (10%)


  Fly    39 PAATCSV-SVSDASGAGASVRTTGRVKKPKQVYDPSDNYVSRASSNRNSLSSVPATSNVQSPPVK 102
            |||...| |||..|....|...:...|: |...........:...||..||...|.|::.....:
Human   360 PAAAAPVSSVSRPSSHDFSFCLSDSFKQ-KHTSKAPQRVCGKRYKNRPGLSYHYAHSHLAEEEGE 423

  Fly   103 EATDSQDSTTSPVSEQQQQQLQQ-----AAQLRNFDTCQKC-GKSEPKRGSGHKSNFLTCKGCMQ 161
            :..|||..|  |||::.::|..:     .|...|:  |..| |.|:..:.:|.....::|..|.:
Human   424 DKEDSQPPT--PVSQRSEEQKSKKGPDGLALPNNY--CDFCLGDSKINKKTGQPEELVSCSDCGR 484

  Fly   162 KWHFPCL---PITFHNQSTARKKFKCDKCRYCRLCNV--RGPGLSICSLCVDAYHPDCNDPTLKQ 221
            ..|..||   |:......|.|  ::|.:|:.|.:|..  ....|..|..|...||..|..|::.:
Human   485 SGHPSCLQFTPVMMAAVKTYR--WQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSE 547

  Fly   222 SKAVEANPNWRCFRC 236
                ....:|.|..|
Human   548 ----PPEGSWSCHLC 558

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2662NP_001284832.1 PHD 134..187 CDD:214584 14/56 (25%)
PHD 189..236 CDD:214584 11/48 (23%)
SAM_Atherin-like 371..438 CDD:188982
SAM 371..436 CDD:197735
DPF2XP_024304405.1 Requiem_N 13..79 CDD:316564
SFP1 <397..417 CDD:227516 6/19 (32%)
PHD1_DPF2_like 456..511 CDD:277161 14/58 (24%)
PHD2_d4 513..558 CDD:277005 11/48 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3744
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.