| Sequence 1: | NP_001284832.1 | Gene: | CG2662 / 31254 | FlyBaseID: | FBgn0024993 | Length: | 446 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001278007.1 | Gene: | Dpf2 / 19708 | MGIID: | 109529 | Length: | 405 | Species: | Mus musculus |
| Alignment Length: | 246 | Identity: | 61/246 - (24%) |
|---|---|---|---|
| Similarity: | 96/246 - (39%) | Gaps: | 41/246 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 DEDKEESPVQPTTHNSSAGSNGHDAKSPVVTTAPAATCSVSVSDASGAGA---SVRTTGRVKKPK 67
Fly 68 QVYDPSDNYVSRASSNRNSLSSVPATSNVQSPPVKEATDSQDS-TTSPVSEQQQQQLQQ-----A 126
Fly 127 AQLRNFDTCQKC-GKSEPKRGSGHKSNFLTCKGCMQKWHFPCL---PITFHNQSTARKKFKCDKC 187
Fly 188 RYCRLCNV--RGPGLSICSLCVDAYHPDCNDPTLKQSKAVEANPNWRCFRC 236 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG2662 | NP_001284832.1 | PHD | 134..187 | CDD:214584 | 14/56 (25%) |
| PHD | 189..236 | CDD:214584 | 12/48 (25%) | ||
| SAM_Atherin-like | 371..438 | CDD:188982 | |||
| SAM | 371..436 | CDD:197735 | |||
| Dpf2 | NP_001278007.1 | Requiem_N | 13..79 | CDD:290758 | |
| PHD1_DPF2_like | 286..341 | CDD:277161 | 14/58 (24%) | ||
| PHD2_d4 | 343..388 | CDD:277005 | 12/48 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3744 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.860 | |||||