DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2662 and dpff-1

DIOPT Version :9

Sequence 1:NP_001284832.1 Gene:CG2662 / 31254 FlyBaseID:FBgn0024993 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_498281.2 Gene:dpff-1 / 175832 WormBaseID:WBGene00016200 Length:372 Species:Caenorhabditis elegans


Alignment Length:272 Identity:60/272 - (22%)
Similarity:99/272 - (36%) Gaps:80/272 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DEDKEES---------PVQPTTHNSSAGSNGHDAKSPVVTTAPAATCSVSVSDASGAGASVRTTG 61
            |||...|         |||..|          .::..|.||..      |||..:.:.:.|:.| 
 Worm   155 DEDDWSSRKRRKGNLGPVQKAT----------SSRKKVPTTRS------SVSRLTPSRSIVKET- 202

  Fly    62 RVKKPKQVYDPSDNYVSRASSNRNSLSSVPATSNVQS---------PPVKEATDSQDSTTSPVSE 117
            :.::|::...|.|    :.|:...||:.:   |..||         |.||..:.|.:.:||    
 Worm   203 KYEEPEEKTYPCD----KCSAKYKSLAGL---SYHQSYLHDQKSSQPLVKLLSPSIEISTS---- 256

  Fly   118 QQQQQLQQAAQLRNFDTCQKC-GKSEPKRGSGHKSNFLTCKGCMQKWHFPCLPITFHNQST---A 178
                             |..| |.:...:.:....:.::|..|.:..|..||  .|:...|   .
 Worm   257 -----------------CDFCSGTAFMNKNTKLPEDLVSCHDCGRSGHPSCL--NFNQNVTKIIK 302

  Fly   179 RKKFKCDKCRYCRLCNV--RGPGLSICSLCVDAYHPDCNDPTLKQSKAVEANPNWRCFRCEACNI 241
            |..::|.:|:.|.:|..  ....|..|..|...||..|..|.|:::...|       :.|..|.:
 Worm   303 RSGWQCLECKSCTICGTSENDDKLLFCDDCDRGYHLYCLTPALEKAPDDE-------YSCRLCQV 360

  Fly   242 --GGSTSASSEE 251
              |...||.:::
 Worm   361 EFGDKASAPAKK 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2662NP_001284832.1 PHD 134..187 CDD:214584 12/56 (21%)
PHD 189..236 CDD:214584 11/48 (23%)
SAM_Atherin-like 371..438 CDD:188982
SAM 371..436 CDD:197735
dpff-1NP_498281.2 Requiem_N 3..77 CDD:290758
SFP1 <19..236 CDD:227516 25/104 (24%)
PHD1_MOZ_d4 257..311 CDD:277001 12/55 (22%)
PHD2_d4 313..358 CDD:277005 12/51 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3744
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.