DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and mllt1b

DIOPT Version :10

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_005171269.1 Gene:mllt1b / 678639 ZFINID:ZDB-GENE-060421-7142 Length:573 Species:Danio rerio


Alignment Length:151 Identity:35/151 - (23%)
Similarity:61/151 - (40%) Gaps:31/151 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WGVYLRPGRDGGDLSRFVRRVTFKMSPRLPLRLHVADSAPFEIGEVLGSDFPVEVQVQYMDARMS 124
            |.|::| |.:..|:..||.||.|::....|....|....|:::.|...:.|.:.::|.:.:..  
Zfish    32 WMVFVR-GPEACDIQHFVERVVFRLHDSFPKPKRVCKEPPYKVEESGYAGFLMPIEVYFKNKE-- 93

  Fly   125 ATSYIFRPRVV---------REGHAGICEEMLDKMIFVNPSPMMRQNLT----------PVLVP- 169
                  .|:.|         .||:..:.....:|:.|.||:...|:.|.          .::|| 
Zfish    94 ------EPKKVCFNYDLFLNLEGNPPVNHLRCEKLTFNNPTHEFRRKLVKAGGVFFSSQAIVVPE 152

  Fly   170 SANGAPGDRTSPQFAMESAMP 190
            .|...|  |.||.:.|...:|
Zfish   153 GAEMMP--RPSPDYPMLPTIP 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 37..153 CDD:341123 21/101 (21%)
mllt1bXP_005171269.1 YEATS_AF-9_like 9..137 CDD:341125 26/113 (23%)
AHD 509..569 CDD:436050
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.