DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and Yeats4

DIOPT Version :8

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_080846.1 Gene:Yeats4 / 64050 MGIID:1927224 Length:227 Species:Mus musculus

Alignment Length:171 Identity:41/172 (24%)
Similarity:76/172 (44%) Gaps:22/172 (13%)


  Fly    60 WGVYLRPGRDGGDLSRFVRRVTFKMSPRLPLRLHVADSAPFEIGEVLGSDFPVEVQVQYMDARMS 124
            |.||::|.|: .|:|.:|:::.||:.......|.|....|:||.|....:|.:.:::.::|....
Mouse    47 WTVYVKPYRN-EDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNER 110

  Fly   125 ATSYIFRPRVVRE------GHAGICEEMLDKMIFVNPSPMMRQNLTPVLVPSANGAPGDRTSPQF 183
            ..:.....::.:.      |...:..|..|:|||.:|:.||:|.||              ||.|.
Mouse   111 PVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLT--------------TSRQL 161

  Fly   184 AMESAMPETPGERKEQDRDREQVGDVARPSQPPAKQPKKRL 224
            .:.:...||.....|. :.||::....:.:.....:.|:||
Mouse   162 TLGAYKHETEFAELEV-KTREKLEAAKKKTSFEIAELKERL 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 17/60 (28%)
Yeats4NP_080846.1 YEATS_GAS41_like 19..155 CDD:341128 28/109 (26%)
Interaction with MLLT10. {ECO:0000250} 163..227 8/41 (20%)
Interaction with TACC1. {ECO:0000250} 168..227 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5033
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S932
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23195
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.