DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2652 and tfg3

DIOPT Version :8

Sequence 1:NP_570015.1 Gene:CG2652 / 31250 FlyBaseID:FBgn0025838 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_593114.1 Gene:tfg3 / 2541729 PomBaseID:SPAC22H12.02 Length:241 Species:Schizosaccharomyces pombe

Alignment Length:59 Identity:20/60 (33%)
Similarity:28/60 (47%) Gaps:1/60 (2%)


  Fly    62 VYLRPGRDGGDLSRFVRRVTFKMSPRLPLRLHVADSAPFEIGEVLGSDFPVEVQVQYMD 120
            |.|.|..:..|.| ||.|||:|:.|............||:|.|....:|.:|:.:.|.|
pombe    40 VCLNPQGEETDAS-FVDRVTYKLHPTFQNPTRTIRKPPFQIKEQGWGEFEMEIIIYYAD 97

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2652NP_570015.1 YEATS 26..>120 CDD:303059 19/58 (33%)
tfg3NP_593114.1 TFG3 1..238 CDD:227366 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23195
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.