DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL7 and AANAT1

Sequence 1:NP_001188542.1 Gene:AANATL7 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_995934.1 Gene:AANAT1 FlyBaseID:FBgn0019643 Length:275 Species:Drosophila melanogaster

Alignment Length:218 Identity:68/219 (31%)
Similarity:112/219 (51%) Gaps:17/219 (8%)


  Fly     4 KMIAPEHSEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAIQHRMSVMAVDAKEKDT 68
            ::|.||..|.|:..|:..||.|||||....|    ..|..||.:..:.:....|..||:.|.   
  Fly    60 ELIQPEDGEAVIAMLKTFFFKDEPLNTFLDL----GECKELEKYSLKPLPDNCSYKAVNKKG--- 117

  Fly    69 LKIVGVVLNGILK---PGDTAKALSKLDCNDDADFRKIFDLLHRHNLKHNLFEHF-DVDCMFDVR 129
             :|:||.|||:::   |.|..:..:  |..:...|:||..|:.....:.|:|:.: |.:.:.|.:
  Fly   118 -EIIGVFLNGLMRRPSPDDVPEKAA--DSCEHPKFKKILSLMDHVEEQFNIFDVYPDEELILDGK 179

  Fly   130 ILSVDSCYRGQGIANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSHGF-EVFSEQPYSKYTD 193
            |||||:.|||.|||..|.:|:....::||..:.....:..:|.::....|| |||..| ::.|..
  Fly   180 ILSVDTNYRGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVFRMQ-FADYKP 243

  Fly   194 ENGKVILPVEAPHIKLQQLYKAI 216
            : |:|:....|||:.:|.:.|.:
  Fly   244 Q-GEVVFKPAAPHVGIQVMAKEV 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 22/60 (37%)
AANAT1NP_995934.1 RimI <168..235 CDD:223532 23/67 (34%)
NAT_SF <183..227 CDD:302625 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1342240
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I3998
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001559
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
44.080

Return to query results.
Submit another query.