DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL7 and AANATL6

Sequence 1:NP_001188542.1 Gene:AANATL7 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_611405.2 Gene:AANATL6 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster

Alignment Length:201 Identity:50/202 (25%)
Similarity:78/202 (39%) Gaps:22/202 (11%)


  Fly    22 FFADEPLNKAAGLCQNGSSCPALEAHCAE-------AIQHRMSVMAVDAKEKDTLKIVGVVLNGI 79
            |..|||:..       |...|....|..|       .|:..:|::|:|......|  ||:.:...
  Fly    30 FHYDEPMGM-------GLEEPIHLQHEEEVDRQYLAVIRQGLSIVALDDNNGGLL--VGIAVAET 85

  Fly    80 LKPGDTA---KALSKLDCNDDADFRKIFDLLHRHNLKHNLFEHFDVDCMFDVRILSVDSCYRGQG 141
            :.|.:.|   |...:::.|.....||....:.|   :.|:||.|.|.....:.::||....|.:|
  Fly    86 MDPIEMAKQHKEAEEMEPNALGRSRKFIAKVER---EANIFERFGVSSYLSLLVISVHPSMRQRG 147

  Fly   142 IANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSHGFEVFSEQPYSKYTDENGKVILPVEAPH 206
            |...|.|....:.:..|..|.....|..:|.:.....|.|......|:.|.||.|:.|....|||
  Fly   148 ILVILSKCLFKLGRLRGHTLFITSGTNHYSSRSAMKAGCECIHSVAYADYKDELGRPIYNPPAPH 212

  Fly   207 IKLQQL 212
            ..::.|
  Fly   213 THIRVL 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 13/59 (22%)
AANATL6NP_611405.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1342211
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.