DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL7 and AANATL3

Sequence 1:NP_001188542.1 Gene:AANATL7 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_610018.1 Gene:AANATL3 FlyBaseID:FBgn0032839 Length:222 Species:Drosophila melanogaster

Alignment Length:208 Identity:55/209 (26%)
Similarity:91/209 (44%) Gaps:12/209 (6%)


  Fly     4 KMIAPEHSEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAIQHRMSVMA-----VDA 63
            :.:..|....|...|:.|||..||      |||:.|. .....:..|..::.:|::|     |..
  Fly    12 RTMTKEDYPSVKAFLKDNFFQSEP------LCQSTSE-NVQSQNEKENDEYHLSMIAQGTCLVAI 69

  Fly    64 KEKDTLKIVGVVLNGILKPGDTAKALSKLDCNDDADFRKIFDLLHRHNLKHNLFEHFDVDCMFDV 128
            .|.:..|.||:||.|...|.|..|...:.:..:...:.:...:|.:...:.||||.|.:..:...
  Fly    70 DESNGGKFVGLVLAGAQYPEDLEKHRIEAESMEQHFWARACIMLSKIEREANLFERFGISKLLYS 134

  Fly   129 RILSVDSCYRGQGIANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSHGFEVFSEQPYSKYTD 193
            .|.||:|..||:|:.:.|....:.|.:..||..:.|..|..:|.:...:.|.:.....||:.|.|
  Fly   135 HITSVESSMRGKGLGSRLAATLMDVGRAKGFPAMTAYCTSFYSARQKEALGMKCVHSLPYADYKD 199

  Fly   194 ENGKVILPVEAPH 206
            :.|:.|.....||
  Fly   200 DQGRPIFTPAEPH 212

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 15/59 (25%)
AANATL3NP_610018.1 NAT_SF <122..182 CDD:302625 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1342323
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.