DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL7 and CG17375

Sequence 1:NP_001188542.1 Gene:AANATL7 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_609076.3 Gene:CG17375 FlyBaseID:FBgn0031861 Length:268 Species:Drosophila melanogaster

Alignment Length:75 Identity:13/76 (17%)
Similarity:35/76 (46%) Gaps:1/76 (1%)


  Fly     1 MEYKMIAPEHSEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAIQHRMSVMAVDAKE 65
            |:...|..::.:.|:|.:..|.|....:.::.||............:....:::..|||.: :::
  Fly    19 MQIVDINSKYYDMVIEFMWSNSFLKSLVYESLGLFDLPDMKQTYSWYVRHILRNECSVMMI-SED 82

  Fly    66 KDTLKIVGVV 75
            :..::.||::
  Fly    83 ETQIRAVGLL 92

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625
CG17375NP_609076.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.