DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL7 and AANATL2

Sequence 1:NP_001188542.1 Gene:AANATL7 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001285667.1 Gene:AANATL2 FlyBaseID:FBgn0031791 Length:216 Species:Drosophila melanogaster

Alignment Length:205 Identity:53/206 (26%)
Similarity:96/206 (47%) Gaps:23/206 (11%)


  Fly    12 EQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAIQHR------MSVMAVDAKEKDTLK 70
            |:|...|..:||..|||     :..........|...|||..||      :|::|||.:     :
  Fly    15 EEVEAFLAVHFFKQEPL-----MLIPQEDPKQSEVSSAEAELHRSLIPQDLSLVAVDGE-----R 69

  Fly    71 IVGVVLNGILKPGDTAKALSKLDCNDDADFRKIFDLLHRH----NLKHNLFEHFDVDCMFDVRIL 131
            ||||||.|.|.|.|..:...:.   :..:...:.|.:|:.    ..:.|:|:|:.|:....:.:|
  Fly    70 IVGVVLAGELVPEDLEREYQEA---EQKEITCLLDKIHKFLAGIERQANIFKHYGVERALYLYML 131

  Fly   132 SVDSCYRGQGIANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSHGFEVFSEQPYSKYTDENG 196
            .||...|.|.:...||:.::.:.::.||.::.:..:...|:::..:...|....:.|:.|.||:|
  Fly   132 GVDVSIRRQRVGTRLVEATIELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYADYKDEHG 196

  Fly   197 KVILPVEAPH 206
            :::|....||
  Fly   197 EIVLRASEPH 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 11/59 (19%)
AANATL2NP_001285667.1 NAT_SF 114..163 CDD:173926 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1342379
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.