DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL7 and W02D7.4

Sequence 1:NP_001188542.1 Gene:AANATL7 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_505142.1 Gene:W02D7.4 WormBaseID:WBGene00020940 Length:232 Species:Caenorhabditis elegans

Alignment Length:217 Identity:48/218 (22%)
Similarity:88/218 (40%) Gaps:35/218 (16%)


  Fly     3 YKMIAPEHSEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAIQHRMSVMAVDAKEKD 67
            :::..|:..|::::.|.::|..:||.::|..:....|                ..|.........
 Worm    14 FRVAQPKDHERIIKFLDKHFAKEEPCSRALKISPEIS----------------RGVFTATVTRCL 62

  Fly    68 TLKIVGVVL--NGILKPGDTAKALSKLDCNDDADFR--------KIF-DLLHRHNLKHNLFEHFD 121
            |.....|||  ||.|.....|...::.|..::|||.        |:| ..|::.:|........:
 Worm    63 TTPFSTVVLQENGDLAACLLASVWNRTDPLENADFDDTGLPENFKLFIQFLNKAHLNFWKIAPPN 127

  Fly   122 VDCMFDVRILSVDSCYRGQGIANELV-----KRSVAVAKKNGFRLLKADATGIFSQKIFRSHGFE 181
            |:.:....|.||...:...|||.::|     ||::   ||.....:.::.|.:.:|.:....||:
 Worm   128 VNSIIHREIGSVAPQFTRLGIATKMVTTNMTKRNL---KKYNIGGVLSETTSLANQIVLEKAGFK 189

  Fly   182 VFSEQPYSKYTDENGKVILPVE 203
            ...|.|||...|..|..:|.::
 Worm   190 CLKELPYSTIVDSKGNQVLKLD 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 16/64 (25%)
W02D7.4NP_505142.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I3998
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 1 0.910 0.875 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.