DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL7 and R13D11.4

Sequence 1:NP_001188542.1 Gene:AANATL7 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_503329.2 Gene:R13D11.4 WormBaseID:WBGene00020058 Length:227 Species:Caenorhabditis elegans

Alignment Length:214 Identity:48/215 (22%)
Similarity:92/215 (43%) Gaps:24/215 (11%)


  Fly     2 EYKMIAPEHSEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAIQHRMSVMAVDAKEK 66
            |:..:..|:|.::.|.|..:|..:||:|:|.|:.:.... |.::......:....|...|   ||
 Worm     7 EFVQLTNENSSELSEFLMSHFLLEEPMNRAIGMSRENFQ-PFVDKLFERTLNIPFSFALV---EK 67

  Fly    67 DTLKIVGVVLNG--ILKPGDTAK----------ALSKLDCNDDADFRKIFDLLHRHNLKHNLFE- 118
            |:.|.....::.  |.:..|.|.          .....:..|.|...||...||     ...|| 
 Worm    68 DSRKFAACAMSSLWINEKNDVAHKDTENHGDEFTFGNPERKDIAAVGKILTELH-----GKFFEI 127

  Fly   119 HFDVDCMFDVRILSVDSCYRGQGIANELVKRSVAVAKKNGFRLLK--ADATGIFSQKIFRSHGFE 181
            ..||:....:.||||...::.:|:|:.|:.:....||...|:..|  ::.:.:.:|.:.:..|:.
 Worm   128 CLDVEQALHLEILSVAKEHQRRGLASRLMAKMEDPAKMREFKCSKIASEISSLANQCLMKKRGYT 192

  Fly   182 VFSEQPYSKYTDENGKVIL 200
            ..:|..::...||:|:.::
 Worm   193 ALTETLFASECDESGRPLI 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 14/61 (23%)
R13D11.4NP_503329.2 Acetyltransf_1 129..192 CDD:278980 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I3998
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D534578at33208
OrthoFinder 1 1.000 FOG0001559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 1 0.910 0.875 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.