DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL7 and M7.12

Sequence 1:NP_001188542.1 Gene:AANATL7 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_502070.2 Gene:M7.12 WormBaseID:WBGene00010887 Length:241 Species:Caenorhabditis elegans

Alignment Length:249 Identity:60/250 (24%)
Similarity:107/250 (43%) Gaps:72/250 (29%)


  Fly     3 YKMIAPEHSEQVMEHLRRNFFADEPLNKAAGLCQNG-SSCPALEAHCAEAIQHRMSVMAVDAKEK 66
            ::.:..::..:|::.|..||..:|||:||||:.::. .||  .:......:::.:|::   |:.|
 Worm    26 FETVKHDNRNEVVDFLNNNFRVEEPLSKAAGMTESDIQSC--FDGVFERVLKNEVSIL---ARSK 85

  Fly    67 DTLKIVGVVLNGILKPGDTAKALSKLDCNDD--ADFR------------KIFDLLHRHNLK---- 113
            .:.:|||.:||.:.|..|..|       |:|  .||.            :|.:.||....|    
 Worm    86 QSDEIVGCMLNSVWKRNDPKK-------NEDEAEDFEFGGDRKGVMTIGEILNELHESFWKLRPD 143

  Fly   114 -HNLFEHFDVDCMFDVRILSVDSCYRGQGIAN---------ELVKRSVAVAKKNGFRLLKADATG 168
             |.:. ||::.        ||:..::.||:|:         ||:| ||..:.      :.|:|:.
 Worm   144 QHTVL-HFEIS--------SVNKNHQRQGLASKFMNWTEKKELLK-SVEASS------IVAEASS 192

  Fly   169 IFSQKIFRSHGFEVFSEQPYSKYTDENGKVILPVEAPHIKLQQLYKAICADDQD 222
            :.:|.:....|:|..:....|...|.|||.||               :|.|..|
 Worm   193 LANQILLSKRGYETVASTLLSSRIDVNGKQIL---------------VCDDGTD 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 15/68 (22%)
M7.12NP_502070.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I3998
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D534578at33208
OrthoFinder 1 1.000 FOG0001559
OrthoInspector 1 1.000 T477065
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 1 0.910 0.933 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R17099
TreeFam 00.000 Not matched by this tool.
88.100

Return to query results.
Submit another query.