DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL7 and T10B5.4

Sequence 1:NP_001188542.1 Gene:AANATL7 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001300192.1 Gene:T10B5.4 WormBaseID:WBGene00020390 Length:237 Species:Caenorhabditis elegans

Alignment Length:213 Identity:52/214 (24%)
Similarity:86/214 (40%) Gaps:40/214 (19%)


  Fly     9 EHSEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAI---------QHRMSVMAVDAK 64
            ||.:||.:.|..:|...||:..:.       ||.  |...||..         ..:.|::..|.:
 Worm    12 EHKDQVHKFLVEHFRVMEPITTSL-------SCS--EEDVAEFFVDLTMSGLEDEKSSILVFDGE 67

  Fly    65 EKDTLKIVGVVLNGILKPGDTAKALSKLDCNDDADFR-KIFDLLHRHNLKHNLFEHFDV------ 122
            |     ||.|.||.:.:....:::   ...|...||. :|.:..::|...:.|.....|      
 Worm    68 E-----IVAVCLNAVKECSFVSES---TPFNPHWDFNAEITNGQYKHENANKLVAFVQVLEQDLS 124

  Fly   123 ------DCMFDVRILSVDSCYRGQGIANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSHGFE 181
                  ..:|.:.:|.|....:|:||..:||::|:..|.|.....:...||.:.||.||...|..
 Worm   125 FLTGNPKKVFKIDVLCVSKACQGKGIGRQLVEKSLENAVKEDCEYVATVATAVASQNIFSKCGLT 189

  Fly   182 VFSEQPYSKYTDENGKVI 199
            ...|.|:|.:.: ||.|:
 Worm   190 TLREMPFSCFRN-NGDVV 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 18/59 (31%)
T10B5.4NP_001300192.1 NAT_SF 107..170 CDD:173926 13/63 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.