DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL7 and R05H10.1

Sequence 1:NP_001188542.1 Gene:AANATL7 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_497076.1 Gene:R05H10.1 WormBaseID:WBGene00011042 Length:250 Species:Caenorhabditis elegans

Alignment Length:225 Identity:45/226 (20%)
Similarity:97/226 (43%) Gaps:17/226 (8%)


  Fly     3 YKMIAPEHSEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAIQHRMSVMAVDAKEKD 67
            |:.......:::::.|..:|:.:||..:|:.:... ...|........:::..:|.:..   .:|
 Worm     7 YRTAEKSDFDRILKFLAEHFYHEEPSIRASKIALE-EWLPIFGEMTTSSLKLPISTVVT---TED 67

  Fly    68 TLKIVGVVLNGILKPGDTAKALSKLDCNDDADFRKIFDLLHR--------HNLKHNLFEHFDVDC 124
            ...||.|:||.:....:..:.:...:...|.|.....:.|.|        |:...||... ||:.
 Worm    68 GENIVAVLLNSMWSREEDEERMKHGNGKGDHDTSGYSEALQRFMTIVQKCHDEFWNLAPS-DVNL 131

  Fly   125 MFDVRILSVDSCYRGQGIANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSHGFEVFSEQPYS 189
            :....|.||...::.||||.:::.|:::.|:.:....:.:..:...:|.:...:||:...|.|||
 Worm   132 VVYREISSVGKPWQRQGIATKMLSRNMSAARLHNVDGIVSATSSFANQTLLAKNGFQCLKEFPYS 196

  Fly   190 KYTDENG-KVILPVEAPH---IKLQQLYKA 215
            .....|| |::...:..|   |..:::.|:
 Worm   197 GIVSSNGDKLVETDDGSHGMRINFKRIEKS 226

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 13/59 (22%)
R05H10.1NP_497076.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1342539
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I3998
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_139228
Panther 1 1.100 O PTHR20905
Phylome 1 0.910 0.875 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.