DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: boi and sdk

Sequence 1:NP_001096868.3 Gene:boi FlyBaseID:FBgn0040388 Length:1105 Species:Drosophila melanogaster
Sequence 2:NP_001284756.1 Gene:sdk FlyBaseID:FBgn0021764 Length:2265 Species:Drosophila melanogaster

Alignment Length:934 Identity:184/935 (20%)
Similarity:299/935 (32%) Gaps:294/935 (31%)


  Fly    22 QASDSNSSVATTLGV----LFERAPESAVAPK------GDEVV-FECELNLKP-DRLEWRFRRGD 74
            |.....||....|.|    ..|.|||..|.|:      |..|| .:|..|.:| ..||       
  Fly   237 QLGKEESSAFVHLNVSGDPYIEVAPEIIVRPQDVKVKVGTGVVELQCIANARPLHELE------- 294

  Fly    75 SSEPYLYLRPSAGYNVTSGSDGLA-------------WR---LRIYVSAQTAGDYQCVAWYGPGA 123
                .|:|:           ||||             |.   ..:..::..:|:|.|......|.
  Fly   295 ----TLWLK-----------DGLAVETAGVRHTLNDPWNRTLALLQANSSHSGEYTCQVRLRSGG 344

  Fly   124 --LASTPARLALVSIALDVGQ------GSMGARSSIRWSVAPKNCLLIRCGSVISNPPAIWSFYR 180
              ..|..|||.::...|....      |..|.:            :.:.| .|:..|.....::|
  Fly   345 YPAVSASARLQILEPPLFFTPMRAETFGEFGGQ------------VQLTC-DVVGEPTPQVKWFR 396

  Fly   181 NGKK----LPQSELLPGAAGALVLDTVTAKDAGNYSCVATNSITGD------------------- 222
            |.:.    :............||:..:...||..:.|:|.|. .|:                   
  Fly   397 NAESVDAHIESGRYTLNTDNTLVIKKLILDDAAMFQCLAINE-AGENSASTWLRVKTKTAKNRVK 460

  Fly   223 ELRLPQTIELRVDY-------------TDRTPPY------FLQRPPIEYSARPGETVVLECPGVG 268
            .|..|:.:.:|..:             :||...:      .::.||...:|..|:...:.|..||
  Fly   461 RLAQPRILRVRASHAGLGSEKGSESGSSDRRKEFRFASAPIMELPPQNVTALDGKDATISCRAVG 525

  Fly   269 SPRPRVIW--SSPNVVEIYNNRSTILSYG-LQITDVKPEDQGSYICMLDNGIAPPIDHTIKLSVL 330
            ||.|.:.|  :...:|:| ::|..||..| |.|::::..|.|.|||:..|. |..:.....||||
  Fly   526 SPNPNITWIYNETQLVDI-SSRVQILESGDLLISNIRSVDAGLYICVRANE-AGSVKGEAYLSVL 588

  Fly   331 QRPTILRGPAATLTNESNPLLLDCSASGNPQP--DIYWLINGEDATKDPEA----VVDNRSLQLK 389
            .|..|::.|..|.........|.|..|.:|..  :|.|...|:.:|....:    |..:..|:::
  Fly   589 VRTQIIQPPVDTTVLLGLTATLQCKVSSDPSVPYNIDWYREGQSSTPISNSQRIGVQADGQLEIQ 653

  Fly   390 RVQKRHAGVVQCFAKNILGETSEGNILRVNPLEITGEDDEPLGEVPVWPVHESNTGMGTSSTSGG 454
            .|:....|...|..                                              ::.||
  Fly   654 AVRASDVGSYACVV----------------------------------------------TSPGG 672

  Fly   455 SKNKSGRRKFKASMVPPSRPNVTRLSD---ESVMLRWSVPQNSGLQITFFKVQYR---MLGDGKN 513
            ::.::.|........|||...|.||.:   .|:.:.|:...:....|:.|.:|.|   .||...:
  Fly   673 NETRAARLSVIELPFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSELGPVPD 737

  Fly   514 RRKNWQTTSDNIPYGNAHGSGPGQGNSHWRARNRDREYEMGNPPKNFTSSVTGLTAGKYYRFRIV 578
            ...||.|...|:           ..:..|                   ..:..|.|...|:||:.
  Fly   738 PLLNWITELSNV-----------SADQRW-------------------ILLENLKAATVYQFRVS 772

  Fly   579 AVYSNNDNKEGNTSLKFFLQNGTSKSNL-----------PVPELREVETLSESAVVLHWS-LVSS 631
            ||   |...||:.|         ..||:           ||..:....::||  ::..|. .:..
  Fly   773 AV---NRVGEGSPS---------EPSNVVELPQEAPSGPPVGFVGSARSMSE--IITQWQPPLEE 823

  Fly   632 TQNEDIDGYYAYYRP-ADSAAEYLKATVDGGMSRSFKIDLLRPGTPYEFKLQSFNSDAASEFSAI 695
            .:|..|.||...||. ..:...:....:.....|:|.|..|.....|..::.::|:.....::..
  Fly   824 HRNGQILGYILRYRLFGYNNVPWSYQNITNEAQRNFLIQELITWKDYIVQIAAYNNMGVGVYTEG 888

  Fly   696 RQARTRK-THEQPASSSATPVPANKAVEQHQNSLYPLIAGAAGGGILLLIASLVVCLCLKRRENS 759
            .:.:|:: ..|.|        |.|..||...::                     ...|.....|.
  Fly   889 SKIKTKEGVPEAP--------PTNVKVEAINST---------------------AARCRWTPPNP 924

  Fly   760 QPEDENKPQLEHIQADFVTSAVLG--VGGHHKSGDVRRLNGVIPRMNITP----NPLAQETA--- 815
            |       |:..|...:...|...  :.|..:  |:.|      ||...|    :|||::||   
  Fly   925 Q-------QINGINQGYKIQAWQRRLIDGEWR--DIER------RMKTVPPSLIDPLAEQTAILG 974

  Fly   816 ---SDKNRNVMELRFLPPLANGNG 836
               .....|:..|.|..|   |:|
  Fly   975 GLEKFTEYNISVLCFTDP---GDG 995

Known Domains:


GeneSequenceDomainRegion External IDIdentity
boiNP_001096868.3 IG_like 42..131 CDD:214653 26/115 (23%)
IG_like 154..234 CDD:214653 16/103 (16%)
Ig 172..234 CDD:299845 14/85 (16%)
IG_like 249..329 CDD:214653 27/83 (33%)
Ig 257..329 CDD:299845 25/75 (33%)
IG_like 339..418 CDD:214653 15/85 (18%)
Ig 352..408 CDD:299845 13/62 (21%)
FN3 470..592 CDD:238020 29/128 (23%)
FN3 613..700 CDD:238020 15/89 (17%)
sdkNP_001284756.1 Ig 71..157 CDD:299845
I-set 72..150 CDD:254352
Ig 172..245 CDD:299845 3/8 (38%)
IG_like 280..356 CDD:214653 20/98 (20%)
Ig 280..343 CDD:299845 15/85 (18%)
IG_like 375..450 CDD:214653 14/89 (16%)
Ig 378..447 CDD:143165 13/71 (18%)
Ig 506..587 CDD:299845 27/83 (33%)
IG_like 506..587 CDD:214653 27/83 (33%)
I-set 592..682 CDD:254352 19/136 (14%)
Ig 595..682 CDD:299845 18/133 (14%)
FN3 686..789 CDD:238020 32/145 (22%)
FN3 798..893 CDD:238020 17/97 (18%)
FN3 901..1005 CDD:238020 28/143 (20%)
fn3 1011..1094 CDD:278470
FN3 1108..1202 CDD:238020
FN3 1210..1308 CDD:238020
fn3 1317..1402 CDD:278470
FN3 1415..1507 CDD:238020
FN3 1513..1608 CDD:238020
fn3 1617..1708 CDD:278470
FN3 1722..1823 CDD:238020
FN3 1828..1920 CDD:238020
FN3 1927..2016 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR44170
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.