DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PsGEF and CG43102

DIOPT Version :10

Sequence 1:NP_996333.4 Gene:PsGEF / 31224 FlyBaseID:FBgn0264598 Length:2777 Species:Drosophila melanogaster
Sequence 2:NP_001247156.1 Gene:CG43102 / 42137 FlyBaseID:FBgn0262562 Length:2519 Species:Drosophila melanogaster


Alignment Length:65 Identity:15/65 - (23%)
Similarity:23/65 - (35%) Gaps:16/65 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NYKRTILITGATDGIGKQTALDLAAHPDNFVIIHGRTEEKCIATKDWI-GKENGNCSNIDYVAGD 68
            |....::..|||.|.               |:|.|.|::.....:..: |...|...|:..|.||
  Fly   124 NLNGGVVAGGATTGT---------------VVIGGVTQQVTQGGQPNVGGNVGGQNQNVGGVVGD 173

  Fly    69  68
              Fly   174  173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PsGEFNP_996333.4 DUF4799 <99..209 CDD:318308
C2 286..>381 CDD:425499
PDZ_canonical 645..716 CDD:483948
RhoGEF 835..1007 CDD:470622
PRK12323 <2304..>2415 CDD:481241
CG43102NP_001247156.1 RhoGEF 1573..1758 CDD:238091
WD40_2 <2201..>2462 CDD:465964
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.