DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL14 and rpl14

Sequence 1:NP_001259186.1 Gene:mRpL14 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_051094.1 Gene:rpl14 ID: Length:122 Species:Arabidopsis thaliana

Alignment Length:130 Identity:35/131 (27%)
Similarity:57/131 (44%) Gaps:35/131 (27%)


  Fly    44 LRVVDNSDLGKKAMAEGRPPRCIHVY--NKRGVGFIGDKVLVAIK----------GQMKKGILV- 95
            |.|.|||.        .|...||.:.  :.|....|||.::..||          .::.:.::| 
plant     8 LNVADNSG--------ARELMCIRIIGASNRRYAHIGDVIVAVIKEAIPNTPLERSEVIRAVIVR 64

  Fly    96 ---GLKQNQKPKQPKFDSNNLVLIDDNGSPLGTRIHVPIPTILRTILKEKTLAKGADYTKVLAIA 157
               .||:| .....::|.|..|:||..|:|.|||:...||..||.:          ::||::::|
plant    65 TCKELKRN-NGTIIRYDDNAAVVIDQEGNPKGTRVFGAIPRELRQL----------NFTKIVSLA 118

  Fly   158  157
            plant   119  118

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL14NP_001259186.1 Ribosomal_L14 38..159 CDD:294234 35/131 (27%)
rpl14NP_051094.1 rpl14 1..122 CDD:176997 35/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1547267at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.