DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mRpL14 and Mrpl14

Sequence 1:NP_001259186.1 Gene:mRpL14 FlyBaseID:FBgn0040389 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_081008.1 Gene:Mrpl14 MGIID:1333864 Length:145 Species:Mus musculus

Alignment Length:137 Identity:69/138 (50%)
Similarity:95/138 (69%) Gaps:10/138 (7%)


  Fly    25 TQQLIHTTPACCEIRKLARLRVVDNSDLGKKAMAEGRPPRCIHVYNKRGVGFIGDKVLVAIKGQM 89
            :|:...|:.:...::|:.|:||||||.||  :....|||||||||||.|||.:||::|:||:||.
Mouse    19 SQRCFSTSGSLSAVQKMTRVRVVDNSALG--STPYHRPPRCIHVYNKSGVGKVGDQILLAIRGQK 81

  Fly    90 KKGILVGLKQNQKPKQPKFDSNNLVLIDDNGSPLGTRIHVPIPTILRTILKEKTLAKGADYTKVL 154
            ||.::||.:.......|||||||:|||:|||:|:||||.:||||.||        .:..:|:|||
Mouse    82 KKALIVGHRMPGSRMTPKFDSNNVVLIEDNGNPVGTRIKIPIPTSLR--------RREGEYSKVL 138

  Fly   155 AIASRYV 161
            |||..:|
Mouse   139 AIAQNFV 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mRpL14NP_001259186.1 Ribosomal_L14 38..159 CDD:294234 66/121 (55%)
Mrpl14NP_081008.1 Ribosomal_L14 32..142 CDD:294234 66/120 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C180297352
eggNOG 1 0.900 E1_KOG3441
Hieranoid 1 1.000
Homologene 1 1.000 H12268
Inparanoid 1 1.050 134 1.000 Inparanoid score I4543
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007877
OrthoInspector 1 1.000 T1085643
orthoMCL 1 0.900 OOG5_134120
Panther 1 1.100 LDO PTHR21037
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3812
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.